KEGG   Frankia sp. EAN1pec: Franean1_7269Help
Entry
Franean1_7269     CDS       T00608                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00010  Glycolysis / Gluconeogenesis
fre00020  Citrate cycle (TCA cycle)
fre00620  Pyruvate metabolism
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01200  Carbon metabolism
Module
fre_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_7269
   00020 Citrate cycle (TCA cycle)
    Franean1_7269
   00620 Pyruvate metabolism
    Franean1_7269
Enzymes [BR:fre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Franean1_7269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABW16588
RhizoBase: Franean1_7269
UniProt: A8L7M3
Position
8873275..8875032
Genome map
AA seq 585 aa AA seqDB search
MTHRQFRLPDLGEGLTEAEIVRWLVEVGETVTVNQPLVEVETAKAVVEIPSPFAGVLVER
HGEAGTELAVGTPLLTIDEPGDEPATGPTTGSVTGATEATGQETTPGDATRNGAASLPVS
RTGEAADVPGGAGTADLSPMAAGRTPMLVGYGPRSDSGPRRRRRPRNPDGPLPGSTTPAA
TIAAPAPAPGTAPTASSAPRAMAPVVSSVPASAPATSPASAAAGAPDRSAVVPIGAAPRH
GRVAAKPPVRKLARDLGVDLSTLAGTGPAGTISRADVETAARQATPPEPAPVPTTATPTT
RTGPVRVPGVVPSSNGIDGPRQPELNGHAATTRRVPGAIPPDAGFNDTDRIWRIPVTGVR
RTMARAMVASVFSAPHATEFLSVDVTETMAARERIAALPDFAGIRVTPLLLVAKALLTAV
RRHPMINSTWVGDTSGENAEIQVHERINLGIAVAGPRGLVVPNIPDAGSRGLVDLARSLH
SLTEAARADRLRPADLSGGTITITNVGVLGVDTGAPVLNPGEAAILALGAIRPAPWVHEG
ELAVRTVAHLALSFDHRVVDGELGSAVLADVAAVLADPVIALAWS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgacccatcgacagttccgcctccccgatctcggcgaggggctgaccgaggcggagatc
gtccggtggctggtggaggtcggcgagaccgtgacggtcaaccagccgctggtcgaggtc
gagacggccaaggcggtcgtcgagatcccgtccccgttcgcgggtgtgctcgtcgaacgg
cacggcgaggccggcaccgagctcgccgtgggcacgccgctgctgaccatcgacgagccg
ggcgacgagcccgcgaccggcccgacgaccgggtcagtcaccggagctaccgaagccacc
ggccaggagaccacgccgggggacgccactcgcaacggcgcggcatccctgcccgtgtcc
cggaccggagaggccgcggacgtcccagggggggccggcacggccgacctgtcaccgatg
gccgccgggcgcaccccgatgctggtggggtacggcccgcgcagcgactccggcccgcgc
cgccggcggcgcccccgcaacccggacggccccctgcccggctcgacgacgcccgcggcg
accatcgccgcccccgcgcccgcccccggcacagcgcccactgccagctcagcgcccagg
gccatggcacccgtcgtgtcgtcggtgccggcctcggcgccagccacatccccggcgtcg
gccgcggccggtgcgccggaccgatcagccgtagtgccgatcggggcagccccgcggcat
gggcgcgtcgcggcgaagccacccgtccgcaagctcgcgcgtgatctgggtgtggacctc
tccacgctcgcgggcaccggtcccgcgggcaccatcagccgcgccgacgtcgaaaccgcg
gcgcgtcaggccacgccccccgagcccgcgcccgtccccaccaccgccactccgacgacc
cgcactgggccggtccgtgtccctggcgttgtcccttcgtccaacggaatcgacggcccg
cgccagccggaactgaacggacacgcggcgaccacacggcgggtgcccggagccatccca
cccgacgccggattcaacgacaccgaccggatctggcggatccccgtcacgggcgtgcgg
cgcaccatggcacgggcgatggtggccagcgtgttctcggccccgcacgccaccgagttc
ctcagcgtggacgtcaccgagacgatggcggcccgcgagcggatcgccgccctgccggac
ttcgccggcatccgggtcacgccgctgctgctcgtggcgaaggcgctcctcaccgccgtc
cggcgccacccaatgatcaactcgacctgggtgggcgacacgtccggggagaacgccgag
atccaggtgcacgagcggatcaacctcggcatcgccgtggccgggccgcgtggcctggtc
gtcccgaacatcccggacgccggatcgcgcggcctggtcgacctcgcccgcagcctgcac
tccctcaccgaggccgcgcgcgccgaccggctgcgcccggccgacctctccggcgggacc
atcaccatcaccaacgtcggagttctcggggtggacaccggggcaccggtcctcaatccc
ggtgaggccgcgatcctcgccctcggcgcgatccgcccggctccctgggtgcacgaaggc
gagctggcggtacggacggtggcccacctcgcgctgtccttcgaccaccgcgtcgtggac
ggcgagctcggctcggcggtcctggccgacgtcgcggccgtcctcgccgaccccgtcatc
gcgctcgcctggagctga

DBGET integrated database retrieval system