KEGG   Frankia sp. EuI1c: FraEuI1c_0073Help
Entry
FraEuI1c_0073     CDS       T01354                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
fri  Frankia sp. EuI1c
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    FraEuI1c_0073
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     FraEuI1c_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85025..86947
Genome map
AA seq 640 aa AA seqDB search
METGGAGPARDDDGQFDVDVLVVGSGFGGSVTALRLAEKGYRVTVVEAGRRFTPSPAATG
STAADAGRPAEAGSGDRRGGGASPLPRNSLDLRRYLWLPWLGCHGIQKITLLGRVLVLSG
AGVGGGSMVYANTLYRPLEAFYADPQWAALADWRAELAPYYDQAERMLGVVPNPTTTYAD
EVFRSVAEEMGVGDTFRLADVGVYFGPPGRPAPGETADDPFFGGAGPRRTGCLECGECMS
GCRHDAKNTLDRNYLYLAERLGVTVVPDTTIQSVTPLPGGGYQVLGAPAGAWPAVTPRGR
ARARRRGRAWRAEQVVFAAGALGTQRLLLAMRDAGRLPDLSPRLGYLTRTNSEAILGATT
VRPDRRITHGVAITSSFYPNEHTHVEPVRYGIGSNALAPLASVMTDGGGRIPRWLKFVGA
CLRRPHLALLAGLPWRWSERTMISLVMQSHDNSLIVRRRRGPGGLSWLTSRQGHGGPNPT
WIPEGNDATRRVAARLGGHPAGSITELANIPITAHILGGATIGESAEHGVVDAYQRVYGH
PGLHVADGAAVTANLGVNPSLTITAQAERAMAFWPNRGEADPRPPLGAPYRRIEPVAPRN
PAVPAAAPAAYRPAGLPVVPVGDLFRSARTTGAAEGPARA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccgggggagcgggaccggcccgggacgacgacggccagttcgacgtcgacgtt
ctggtggtgggtagcgggttcggcggaagcgtgacggcgctgcgcctcgccgagaagggc
taccgggtgacggtcgtcgaggccggacgccggttcactccgtcacccgcggctaccggt
agcacggccgccgatgccggccgcccggccgaggcgggctcgggtgaccgccggggcggc
ggagcgtcgccgttgccgcgcaacagcctggacctgcggcgatacctgtggctgccctgg
ctgggctgccacggaatccagaagatcacgctgctgggccgggtgctggtgctctccggt
gccggcgtcggtggcggctcgatggtctacgcgaacacgctctaccgcccgctggaggcg
ttctacgccgacccgcaatgggcggccctcgccgactggcgggccgaactggcgccctac
tacgaccaggccgagcgaatgctcggggtggtccccaacccgacgacgacctacgccgac
gaggtcttccgttccgtggccgaggagatgggcgtcggcgacaccttccgactggccgat
gtcggcgtctacttcggcccacccggccggcccgccccgggggagacggccgacgacccg
ttcttcggcggtgccgggccgcggcgcaccggctgcctggagtgcggcgagtgcatgagc
ggctgccgccacgacgccaagaacaccctcgaccgcaactacctctacctggcggaacgg
ctcggcgtcacggtcgtgcccgacaccacgatccagtcggtcaccccgctgcccggcggc
ggttaccaggtcctcggcgcaccggccggtgcctggcccgcggtgaccccgaggggccgc
gcgcgggcgcggcggcgcgggcgcgcctggcgggccgagcaggtcgtgttcgccgccggg
gcgctcggcacccaacggctgctgctcgcgatgcgcgacgccggccggctgcccgacctc
tcgccccggctcggctacctgaccaggacgaactcggaggccatcctcggcgcgacgacg
gtccgcccggaccggcggatcacccacggggtggcgatcacgtccagcttctatccgaac
gagcacacccacgtcgagccggtccgctacggcatcggcagcaacgcgctggcgccgttg
gcgtcggtgatgacggacgggggcgggcggataccccggtggctgaagttcgtcggcgcc
tgcctgcgccggccgcacctggcgctgctcgccgggctgccgtggcggtggtccgagcgg
acgatgatctccctcgtcatgcagtcccacgacaactcgctgatcgtgcgccgccgtcgc
gggccggggggcctgtcctggctgaccagccgtcagggccacggcggaccgaacccgacc
tggatccccgagggcaacgacgcgacacgccgggtcgccgccagactcggcggccatccc
gcgggttcgatcacggagctggcgaacatcccgatcacggcgcacatcctgggcggcgcc
acgatcggggagtccgcggagcacggggtggtcgacgcctaccagcgcgtctacgggcac
ccgggcctgcatgtcgccgacggggccgccgtcaccgcgaacctgggcgtcaacccgtca
ttgacgatcacggcgcaggcggagcgggcgatggcgttctggccgaacaggggcgaggca
gacccgcgtccgccgcttggcgcgccctaccggcgaatcgagccggtggcgccgcgcaac
ccggccgttccggccgccgcccccgccgcctaccgcccggcggggcttccggtcgtgccc
gtcggcgatctgttcaggtcggctcggacgaccggggcagccgaaggacccgcacgggcc
tag

DBGET integrated database retrieval system