KEGG   Frankia sp. EuI1c: FraEuI1c_0093Help
Entry
FraEuI1c_0093     CDS       T01354                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fri  Frankia sp. EuI1c
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:fri03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(110573..111451)
Genome map
AA seq 292 aa AA seqDB search
MPELPEMEALASVLRDRAVGKVVTRAEPVAINALRTVSPGPADLVGATLVDATRHGKFLD
LVFAGTGGERLDLVAHLSRAGWLRWKDSQPTTPGRGGRGGLAWRLVFDDGSGFDLTEAGT
QKRLAVYLVRDPAEVPGVARLGIDPLDPAFTVEALAALLTAAGRSQVKGVLTDQSVLAGV
GNAYSDEVLWAARLSPFAPSSGLSGDQVAALHEALVGTLRAAVEAAGGLGAADLKAEKKA
NLAVHARTGEACPRCGDTVRQVSFADRSLQYCPTCQTGGRLLADRRLSRLLK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgcccgagatggaggcgctcgcgagcgtgctgcgcgaccgcgcggtcggc
aaggtcgtcacgagggccgagccggtcgccatcaacgcactgcgcaccgtctcgcctggc
ccggccgacctggtcggcgcgaccctggtcgacgccacgcggcacggcaagttcctcgac
ctcgtcttcgccggcaccggcggcgagcggctcgacctcgtcgcgcacctgtccagggcc
ggctggctgcgctggaaggacagccagccgacgacgcccggccgcggcgggcgcggtggc
ctcgcctggcggctggtgttcgacgacgggtccggcttcgacctcaccgaggccggcacc
cagaagcggctggccgtctacctggtgcgcgacccggccgaggtgcccggtgtggcccgg
ctgggcatcgacccgctggaccccgccttcaccgtcgaggcgctggccgccttgctcacc
gccgccgggcgcagccaggtcaagggcgtactgaccgaccagtcggtcctcgccggggtc
ggcaacgcctactcggacgaggtgctgtgggcggccaggctgtccccgttcgccccgtcc
agcggcctgtccggcgatcaggtcgccgccctgcacgaagccctggtgggaacgctgcga
gcggccgtcgaggcggccggcgggctgggcgccgccgacctgaaggcggagaagaaggcc
aacctggccgtgcacgcgcggaccggcgaggcctgtccgcgctgcggcgacaccgtccgc
caggtctcgttcgcggaccgcagcctgcagtactgccctacctgccagaccggcggccgg
ctactcgccgaccgccgcctgtcccgcctgctgaagtag

DBGET integrated database retrieval system