KEGG   Frankia sp. EuI1c: FraEuI1c_0115Help
Entry
FraEuI1c_0115     CDS       T01354                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fri  Frankia sp. EuI1c
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FraEuI1c_0115
Enzymes [BR:fri01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FraEuI1c_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
141182..142048
Genome map
AA seq 288 aa AA seqDB search
MTVDAMARLLAAGPTRVMGIVNVTPDSFSDGGTFAEPSDAVRAGLRMVADGADIVDVGGE
STRPGAARVDAAEERRRVVPVIERLVAAGVTVSVDTTRAAVAAAALDAGAVLVNDVSAAA
DPDLLALCAERDAYYVLMHARGESIDMAKRAHYGDVVADVVAELRERLAAVYAAGVRPDR
VILDPGIGFAKRFEHNWSLLAQVGAFAELGRPLLVGTSRKSFLGALLAAPDGTPRPVEQR
EDATQATTTLLAAEGVWAVRVHAVRPAVDAVRVVGAWRRARGWPRETG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgacgcgatggcgcggctgctcgcggccggcccgacccgggtgatgggcatc
gtcaacgtcacgcccgactcgttctccgacggcggcaccttcgccgagccgtccgacgcg
gtgcgggccgggctgcggatggtcgccgacggcgccgacatcgtcgacgtcggcggcgag
tcgacccgtccgggagcggcccgggtcgacgccgccgaggagcgccgccgggtggtcccg
gtcatcgagcgcctggtcgccgcgggggtgacggtgagcgtcgacacgaccagggccgcc
gtggccgcggcggccctggatgccggcgcggtgctcgtcaacgacgtgtccgccgcggcg
gacccggacctgctcgcgctgtgcgccgagcgggacgcgtactacgtgctcatgcacgcc
cgcggcgagagcatcgacatggccaaacgggcgcattacggcgacgtcgtcgcggacgtc
gtcgccgagctgcgcgagcggctcgccgccgtgtacgcggccggggtccggccggaccgg
gtgatcctcgaccccgggatcggcttcgccaagaggttcgagcacaactggtcgctgctg
gcccaggtgggcgcgttcgccgagcttggccggccgctgctggtcggcacgtcccgaaag
tccttcctgggcgcgctgctcgccgcgccggacggcacgccccggccggtcgagcagcgc
gaggacgccacccaggcgacgaccacgctgctcgccgccgagggagtctgggcggtccgg
gtgcacgcggtgcgtcccgcggtcgacgccgtccgcgtggtcggtgcgtggcgccgggcc
cgcggctggccgcgggagaccggctga

DBGET integrated database retrieval system