KEGG   Frankia sp. EuI1c: FraEuI1c_0137Help
Entry
FraEuI1c_0137     CDS       T01354                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FraEuI1c_0137
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FraEuI1c_0137
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FraEuI1c_0137
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FraEuI1c_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(176492..177775)
Genome map
AA seq 427 aa AA seqDB search
MTLAPERAAQSGSTTDDANPAVSLSCRHCGATYPLGPQHVCFECFAPLEIAYDEDRLRRV
TRASIEAGPQNLWRYVGLLPAGHDPARRVSLGAGFTPLRPAPRLAAELGMKTLWVKDDSA
NPTHSFKDRVVSVALSAARDLGFTTVACASTGNLAHSVAAHAAHTGLRSIVLVPHDLEDG
KTVSTAVYGGTLVAIKGNYDDVNKLCSQLADEYEWAFVNVNVRPFYAEGSKTLGYEVAEQ
LGWRLPAQVVIPIASGSLLTKVDKAFRELGKLGLVEPTPYKVFGAQAAGCNPVAAAFERG
VDTVSPVRPSTIAKSLSIGNPADGPYALDVARRTGGAITDVTDDEIIEGMRLLARTEGIF
GETAGGVTVANLRRQLREGLLDPDAETVIYNTGDGLKTLDPLVGIAGPTATIPPTLSAFE
AAGLGDD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgcgcccgagcgcgccgcccagtcgggctccacgaccgatgacgcgaacccc
gcggtctcgctttcctgtcgccactgtggcgcgacctacccgctcggcccgcaacacgtc
tgcttcgagtgtttcgcgccgctggagatcgcctacgacgaggaccggctgcgccgggtg
acccgcgcgtccatcgaggccggtccgcagaacctgtggcgctacgtcggcctgctgccc
gccggccacgacccggcccgtcgggtatccctcggcgccggcttcaccccgctgcgtccg
gcgccgcggctggccgccgagctgggcatgaagaccctctgggtcaaggatgacagcgcg
aacccgacgcactcgttcaaggacagggtcgtctccgtcgcgctgtccgccgcccgtgac
ctgggcttcaccaccgtcgcctgtgcgtccaccggcaacctcgcgcattcggtcgccgcg
cacgccgcccacacgggcctgcggtcgatcgtcctggtcccgcacgacctggaggacggc
aagaccgtctcgaccgccgtctacggcggcacccttgtcgcgatcaagggcaactacgac
gacgtgaacaagctgtgcagccaactggccgacgagtacgagtgggcgttcgtcaacgtc
aacgtccgcccgttctacgccgagggctcgaagacgctcggctacgaggtcgccgagcag
ctcggctggcggctgcccgcgcaggtggtcatcccgatcgcgtccggctcgctgctgacc
aaggtcgacaaggcgttccgcgaactgggcaagctcggcctggtcgagccgacgccgtac
aaggtcttcggcgcccaggccgccggctgcaacccggtcgcggcggccttcgagcgcggc
gtcgacacggtctcccccgtccgcccgtcgacgatcgccaagtcgctctcgatcggcaac
ccggccgacggcccctacgcgctcgacgtcgcccgccgcaccggcggcgcgatcaccgac
gtcaccgacgacgagatcatcgagggcatgcgcctgctcgcccgcaccgagggcatcttc
ggcgagaccgccggcggcgtgaccgtcgcgaacctgcgccgccagctgcgcgagggcctg
ctcgaccccgacgccgagaccgtcatctacaacaccggcgacggcctgaagaccctcgac
cccctggtcggcatcgccggccccaccgcgacgatccccccgaccttgtccgccttcgag
gccgcggggctgggcgacgactga

DBGET integrated database retrieval system