KEGG   Frankia sp. EuI1c: FraEuI1c_0473Help
Entry
FraEuI1c_0473     CDS       T01354                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FraEuI1c_0473
Enzymes [BR:fri01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     FraEuI1c_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572913..575093
Genome map
AA seq 726 aa AA seqDB search
MPLFPFSAIVGMDDLRLALVLNAVCPEIGGVLVRGEKGTAKSTAVRALAGVLPPVAVVAG
CRFSCDPARPDKECPDGPHPAAAPASHRPTRLCELPVGATEDRLLGSLDIERALTAGVVM
FEPGLLAAAHRGVLYVDEVNLLHDHLVDLLLDAAALGVAHVERDAVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVQVAAPREPALRAEVVRRRLAFDADPDAFAARYEDAERELSA
RIAAARAALPAVRLPDRELTRIAAVCAAFEVDGLRADLVTARAAVAHAAWAGRAEVTEDD
VRAAVELALPHRRRRDPFDAPGLEPDALDAALEAARKELDALPSQDDAGQDDEGRDGPSE
GQGQGDQDATHDAAPPTGPDGQTDLDSDPDPGGPGGGVPAAGADDEGHPAPEGQAGDQMA
PPPATRPAVGVVAPAATFRARRLEVPGVGGGVPGRRSRAATPSGAVVGAQVPAGRLRDPH
LLATLLAAAPHQLARGRGGPGLRLRPADLRQARREGREGNLVLFVVDASGSMAARARMGA
VKAAVLSLLLDAYQRRDKIGLVTFRGEDARLALPPTSSVDVAATLLADLPSGGRTPLADG
LLLAHRVLARERLRDPSRRPLLVVLTDGRHTAGPRPGPAARLLARSGVAAVVVDCEAGRV
RLGLAGELAATLGATLLGLAELGAPGTGPEAAGPGGGRGRRDPAGLDSAAAGAGLAATVR
ALRDAA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgcccctgttccccttcagcgcgatcgtcggtatggacgatctgcggctcgcgctggtc
ctgaacgcggtctgccccgagatcggcggtgtgctggtccggggcgagaagggcacggcc
aagtcgacggcggtgcgcgcgctcgccggcgtgctgccgccggtcgcggtggtggccggc
tgccggttctcctgcgacccggcccgcccggacaaggaatgccccgacggcccgcatccg
gccgcggccccggcctcgcaccggccgacccggctgtgcgagctgcccgtgggcgcgacg
gaggaccgcctgctcggctccctcgacatcgaacgggcgctgaccgccggcgtcgtcatg
ttcgagccggggctgctcgccgccgcgcaccggggcgtcctctacgtcgacgaggtcaac
ctgctgcacgaccatctggtcgacctgcttctcgacgcggctgcgctcggcgtggcccac
gtcgagcgtgacgcggtgtcggtccggcacgcggcccggttcctgctcgtcgggacgatg
aacccggaggagggcgagctgcggccgcagctgctcgaccggttcggactgacggtgcag
gtcgcggctccgcgcgagccggcgctgcgggccgaggtcgtccgccgccggctggccttc
gacgccgatcccgacgccttcgccgcccggtacgaggacgcggagcgggagctctcggcg
cggatcgccgccgcccgcgcggcgctgccggccgtccggctgcccgaccgggaactgacc
cggatcgccgccgtctgcgccgcgttcgaggtcgacgggctgcgggcggatctggtgacc
gcgcgggccgcggtcgcgcacgcggcctgggccgggcgggccgaggtcaccgaggacgac
gtccgggccgcggtcgagctggcgcttccgcaccgccgtcgccgcgacccgttcgacgcg
ccaggcctggagcccgacgcgctcgacgccgcactggaggcggcccgcaaggagctcgac
gccctcccaagccaggacgacgcgggccaggacgatgagggccgggacggcccgagcgag
ggccagggccagggcgaccaggacgcgacccacgacgcggcgccacccaccgggccggac
ggccagaccgacctggacagcgacccggatcccggcggccccggcggcggcgttccggcc
gccggcgcggacgacgagggccaccccgcgcccgaagggcaggccggggaccagatggcg
ccaccgccggccacccggccggcggtaggcgtggtcgcgcccgcggcgacgttccgcgcc
cgccggctggaggtgcccggcgtcggcgggggcgtgcccggccgacgctctcgcgcggcc
accccgtccggcgccgtggtcggcgcccaggtcccggccggccggctgcgtgacccgcac
ctccttgcgacgctgctggcggcggcgccgcaccagttggcccgcggccgtggcggtccg
gggctgcggctgcggcccgccgacctgcgccaggccaggcgggagggccgcgagggcaac
ctcgtgctgttcgtcgtcgatgcgtcgggctcgatggcggcacgggcgcggatgggcgcc
gtcaaggccgccgtgctctcgctgctgctcgacgcctaccagcgccgcgacaagatcggg
ctcgtcacgttccgcggcgaggacgcccggctggcgctcccgccgacgtcgtcggtggac
gtggcggcgacgctgctggcggacctgccgtcgggcgggcgcactccgctcgccgacggc
ctgctgctcgcgcaccgcgtgctggcccgggaacggctgcgcgacccgagccgccggccg
ttgctggtcgtgctgaccgacggcaggcacaccgcggggccgcggccgggcccggccgcg
cggctgttggcccgctccggcgtcgcagcggtcgtcgtcgactgtgaggcgggacgggtg
cgcctcggcctggcgggtgagctcgccgccacgctgggcgccacgctgctcgggctcgcc
gagctgggcgcgcccggcaccgggccggaggccgccgggccaggcggcgggcgcggcagg
cgagatccagcgggcctcgactccgccgccgccggcgccgggctcgcggccaccgtccgc
gcgctgcgggacgccgcctga

DBGET integrated database retrieval system