KEGG   Frankia sp. EuI1c: FraEuI1c_0541Help
Entry
FraEuI1c_0541     CDS       T01354                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fri  Frankia sp. EuI1c
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FraEuI1c_0541
   00052 Galactose metabolism
    FraEuI1c_0541
   00500 Starch and sucrose metabolism
    FraEuI1c_0541
   00520 Amino sugar and nucleotide sugar metabolism
    FraEuI1c_0541
Enzymes [BR:fri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FraEuI1c_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677668..678588
Genome map
AA seq 306 aa AA seqDB search
MPVTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPAIEYVVEEAARAGLRDVLLVTSRSK
KAVEDHFDRDAELELALERKGDGARLARVRGSAELAEVHSVRQGAPRGLGHAVLCGAPHV
GDEPFAVLLGDDLIDERDPLLEEMLAVQERFGGSVIALMEVPEEVVSLYGVATVDPAPVA
AGGRYETVRIRDLVEKPPADEAPSNLAIIGRYVLAPKVFEVLRRTPPGRGGEIQLTDALR
ELAQAADEVGEPVHGVVFTGRRYDTGDRVDYLKAVIRLACERADLGPEIYPWLEEYVANG
GPKADN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgacgaaggcggttattccggctgcgggcctcgggacccggttccttccggcg
acgaaggccgtgccgaaggagatgctgcccgtcgtagaccgcccggccatcgaatacgtg
gtcgaagaggccgcccgcgccggcctgcgggacgttctgctcgtcaccagccggtcgaag
aaggccgtcgaggaccacttcgaccgcgatgcggagctggagctggcgctggagcgcaag
ggcgacggggcccggctcgcgcgggtgcgtgggtccgcggagctcgccgaggtgcactcg
gtccgccagggcgcgccgcgcggcctcgggcacgccgtgctgtgcggcgccccgcacgtg
ggtgacgagccgttcgcggtgcttctcggcgacgacctgatcgatgagcgggatccgctc
ctcgaggagatgctcgccgtgcaggagcggttcggcggcagcgtgatcgcgctgatggag
gtgccggaggaggtcgtctcgctctacggcgtcgccaccgtggatccggcgccggtcgcg
gccggcgggcgttacgagaccgtccgcatccgcgacctggtcgagaagccgccggccgac
gaggcgccgagcaatctggcgatcatcggccgctatgtgctcgcgcccaaggtcttcgag
gtgctgcgccgcacgccgcccggccgcggcggcgagatccagctgaccgacgcgctgcgg
gagctggcgcaggccgccgacgaggtcggcgagcccgtgcacggcgtcgtgttcaccggg
cgtcgctacgacaccggcgaccgggtcgactacctgaaggccgtcatccggctggcctgc
gagcgggccgacctgggccccgagatctacccgtggctggaggagtacgtcgcgaacggc
ggtccgaaggcggacaactag

DBGET integrated database retrieval system