KEGG   Frankia sp. EuI1c: FraEuI1c_0620Help
Entry
FraEuI1c_0620     CDS       T01354                                 

Definition
(GenBank) Stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
fri  Frankia sp. EuI1c
Pathway
fri01040  Biosynthesis of unsaturated fatty acids
fri01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FraEuI1c_0620
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FraEuI1c_0620
Lipid biosynthesis proteins [BR:fri01004]
 Desaturase
  First
   FraEuI1c_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ADP78698
UniProt: E3JCK2
Position
778379..779410
Genome map
AA seq 343 aa AA seqDB search
MSTTETVQPTDSSPPDRRGGVDLSAVPAAGAASAPSNEHTSAPRWMIKARTEQVVLASII
LVPIAALIAAVPLLWDHWITWHDLVIAAFMYAITGHGVTVGFHRYFTHRGFKTSRPVRIA
LAVFGNMAIEGPVIRWVADHRRHHAHSDQAGDPHSPWRYGPGTRALTKGLWHAHIGWLFD
VEQTDQRKYAPDLLDDKDIVLVSRTFAFCAFVSLALPALIGGLWDGSFEGALRAFFWGGL
VRVALLHHTTWSVNSICHVAGKHPYKSRDRSGNVWWMCLPSMGESWHNLHHAEPTSARHG
VRPWQIDSSFYIIKTMELTGLVRDVRLPTRDRLAKLAATAPAN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaccgagacggtgcagcctacggattccagcccgccggatcggcgaggtgga
gtggacctgagcgcggttcccgccgcgggcgccgccagcgctccctccaacgagcacacc
agcgccccccgctggatgatcaaggcccggaccgagcaggtggtgctggccagcatcatc
ctcgttccgatcgcggcgctgatcgccgcggtcccgctgctgtgggaccactggatcacc
tggcacgacctggtgatcgccgcgttcatgtacgccatcaccggccacggcgtcacggtc
gggttccaccggtacttcacccaccgcggcttcaagacctcgcggccggtccggatcgcg
ctcgccgtcttcggcaacatggcgatcgagggcccggtcatccgctgggtcgccgaccac
cggcgccaccacgcccacagcgaccaggccggcgacccgcactcgccgtggcgctacggc
cccggcacccgggcgctgaccaagggcctgtggcacgcacacatcggctggctcttcgac
gtcgagcagaccgaccagcgcaagtacgcgccggacctgctggacgacaaggacatcgtg
ctcgtcagccggacgttcgccttctgcgcgttcgtcagcctggcgttgccggccctcatc
ggcgggctgtgggacggctccttcgagggcgcgctgcgggccttcttctggggcggcctg
gtccgggtggcgctgctgcaccacaccacctggtcggtgaacagcatctgccacgtcgcc
ggcaagcacccgtacaagtcgcgtgaccgctccggcaacgtgtggtggatgtgcctgccg
tcgatgggcgagtcctggcacaacctgcaccacgccgagccgacctcggcccgccacggc
gtgcggccctggcagatcgactccagcttctacatcatcaagacgatggagctgaccggc
ctggtccgcgacgtgcgccttcccacccgcgaccgcctggccaaactcgccgcgacggcc
cctgctaactaa

DBGET integrated database retrieval system