KEGG   Frankia sp. EuI1c: FraEuI1c_0620Help
Entry
FraEuI1c_0620     CDS       T01354                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fri  Frankia sp. EuI1c
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fri01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:fri01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778379..779410
Genome map
AA seq 343 aa AA seqDB search
MSTTETVQPTDSSPPDRRGGVDLSAVPAAGAASAPSNEHTSAPRWMIKARTEQVVLASII
LVPIAALIAAVPLLWDHWITWHDLVIAAFMYAITGHGVTVGFHRYFTHRGFKTSRPVRIA
LAVFGNMAIEGPVIRWVADHRRHHAHSDQAGDPHSPWRYGPGTRALTKGLWHAHIGWLFD
VEQTDQRKYAPDLLDDKDIVLVSRTFAFCAFVSLALPALIGGLWDGSFEGALRAFFWGGL
VRVALLHHTTWSVNSICHVAGKHPYKSRDRSGNVWWMCLPSMGESWHNLHHAEPTSARHG
VRPWQIDSSFYIIKTMELTGLVRDVRLPTRDRLAKLAATAPAN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaccgagacggtgcagcctacggattccagcccgccggatcggcgaggtgga
gtggacctgagcgcggttcccgccgcgggcgccgccagcgctccctccaacgagcacacc
agcgccccccgctggatgatcaaggcccggaccgagcaggtggtgctggccagcatcatc
ctcgttccgatcgcggcgctgatcgccgcggtcccgctgctgtgggaccactggatcacc
tggcacgacctggtgatcgccgcgttcatgtacgccatcaccggccacggcgtcacggtc
gggttccaccggtacttcacccaccgcggcttcaagacctcgcggccggtccggatcgcg
ctcgccgtcttcggcaacatggcgatcgagggcccggtcatccgctgggtcgccgaccac
cggcgccaccacgcccacagcgaccaggccggcgacccgcactcgccgtggcgctacggc
cccggcacccgggcgctgaccaagggcctgtggcacgcacacatcggctggctcttcgac
gtcgagcagaccgaccagcgcaagtacgcgccggacctgctggacgacaaggacatcgtg
ctcgtcagccggacgttcgccttctgcgcgttcgtcagcctggcgttgccggccctcatc
ggcgggctgtgggacggctccttcgagggcgcgctgcgggccttcttctggggcggcctg
gtccgggtggcgctgctgcaccacaccacctggtcggtgaacagcatctgccacgtcgcc
ggcaagcacccgtacaagtcgcgtgaccgctccggcaacgtgtggtggatgtgcctgccg
tcgatgggcgagtcctggcacaacctgcaccacgccgagccgacctcggcccgccacggc
gtgcggccctggcagatcgactccagcttctacatcatcaagacgatggagctgaccggc
ctggtccgcgacgtgcgccttcccacccgcgaccgcctggccaaactcgccgcgacggcc
cctgctaactaa

DBGET integrated database retrieval system