KEGG   Frankia sp. EuI1c: FraEuI1c_0622Help
Entry
FraEuI1c_0622     CDS       T01354                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fri  Frankia sp. EuI1c
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:fri00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(781454..782467)
Genome map
AA seq 337 aa AA seqDB search
MSTELSTGSTLSPESSPSRVTVRAPAKVNLHLGVGPRRADGFHEVITVLQAVGLYDELTV
TDLEPTDGSDDGPAVTATVEISGEGAVGPAGDPAVVPTNADNLAVRAALLVAETAGLRGR
RIHLEMAKGIPVAAGMAGGSADGAAALVACDALWGTGLPVQTLAELAARLGSDVPFPLTG
GTALGVGRGEQLSLVATAGEYHWVFALADGGLSTPSVYREFDSGATEGRTADGRTAPTPA
DAVLTAVATGDPAVLGAALCNDLQAPAIRLRPSLGDVLAEGRALGALGALVSGSGPTTAF
LARDAAHGAELAAGLAASGLARAVRQASAPAPGATVL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgagctttcgaccggatcgacgttgtcgcccgagtcctcgccgagccgcgtc
accgtccgcgcgccggccaaggtcaacctgcatctgggggtcgggcctcgtcgcgccgac
ggcttccacgaggtcatcaccgtgttgcaggccgtcgggctgtacgacgagctgaccgtc
accgacctggagccgaccgacggctccgacgacggaccggcggtcaccgcgaccgtcgag
atcagcggcgagggtgccgtcgggccggcgggcgaccccgccgtggtcccgacgaacgcg
gacaacctcgcggtccgcgcggcgctcctggtcgccgagaccgccggcctgcgcggccgc
cggattcacctcgagatggccaagggcatcccggtggccgccgggatggccgggggcagc
gccgacggcgccgccgcgctcgtcgcctgcgacgcgttgtggggcacgggcctgcccgtc
cagacgctcgccgagctcgccgcccgcctcggcagcgacgtgccgttcccgctgaccggg
ggcaccgcgctcggcgtcggccgcggcgagcagctctccctcgtcgccaccgccggcgag
taccactgggtgttcgcgctcgccgacggcggcctgtcgacgccgtccgtctaccgggag
ttcgacagcggcgcgaccgagggccgcacggccgacggccgtaccgcgccgactccggcc
gacgcggtactgaccgccgtcgccaccggcgacccggccgtgctcggcgccgcgttgtgc
aacgaccttcaggcgccggcgatcaggctgcggccgtcgctcggcgacgtgctggccgaa
ggccgggcgctcggcgcgctcggcgcgctggtctccggctccggcccgacgacggccttc
ctcgcccgcgacgcggcccacggcgccgagctcgccgccggactcgcggcgagcggcctg
gcccgcgccgtccgtcaggcgtccgcgccggcccccggcgcgacggtgctgtag

DBGET integrated database retrieval system