KEGG   Frankia sp. EuI1c: FraEuI1c_0622Help
Entry
FraEuI1c_0622     CDS       T01354                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00900  Terpenoid backbone biosynthesis
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FraEuI1c_0622
Enzymes [BR:fri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     FraEuI1c_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADP78700
UniProt: E3JCK4
Position
complement(781454..782467)
Genome map
AA seq 337 aa AA seqDB search
MSTELSTGSTLSPESSPSRVTVRAPAKVNLHLGVGPRRADGFHEVITVLQAVGLYDELTV
TDLEPTDGSDDGPAVTATVEISGEGAVGPAGDPAVVPTNADNLAVRAALLVAETAGLRGR
RIHLEMAKGIPVAAGMAGGSADGAAALVACDALWGTGLPVQTLAELAARLGSDVPFPLTG
GTALGVGRGEQLSLVATAGEYHWVFALADGGLSTPSVYREFDSGATEGRTADGRTAPTPA
DAVLTAVATGDPAVLGAALCNDLQAPAIRLRPSLGDVLAEGRALGALGALVSGSGPTTAF
LARDAAHGAELAAGLAASGLARAVRQASAPAPGATVL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgagctttcgaccggatcgacgttgtcgcccgagtcctcgccgagccgcgtc
accgtccgcgcgccggccaaggtcaacctgcatctgggggtcgggcctcgtcgcgccgac
ggcttccacgaggtcatcaccgtgttgcaggccgtcgggctgtacgacgagctgaccgtc
accgacctggagccgaccgacggctccgacgacggaccggcggtcaccgcgaccgtcgag
atcagcggcgagggtgccgtcgggccggcgggcgaccccgccgtggtcccgacgaacgcg
gacaacctcgcggtccgcgcggcgctcctggtcgccgagaccgccggcctgcgcggccgc
cggattcacctcgagatggccaagggcatcccggtggccgccgggatggccgggggcagc
gccgacggcgccgccgcgctcgtcgcctgcgacgcgttgtggggcacgggcctgcccgtc
cagacgctcgccgagctcgccgcccgcctcggcagcgacgtgccgttcccgctgaccggg
ggcaccgcgctcggcgtcggccgcggcgagcagctctccctcgtcgccaccgccggcgag
taccactgggtgttcgcgctcgccgacggcggcctgtcgacgccgtccgtctaccgggag
ttcgacagcggcgcgaccgagggccgcacggccgacggccgtaccgcgccgactccggcc
gacgcggtactgaccgccgtcgccaccggcgacccggccgtgctcggcgccgcgttgtgc
aacgaccttcaggcgccggcgatcaggctgcggccgtcgctcggcgacgtgctggccgaa
ggccgggcgctcggcgcgctcggcgcgctggtctccggctccggcccgacgacggccttc
ctcgcccgcgacgcggcccacggcgccgagctcgccgccggactcgcggcgagcggcctg
gcccgcgccgtccgtcaggcgtccgcgccggcccccggcgcgacggtgctgtag

DBGET integrated database retrieval system