KEGG   Frankia sp. EuI1c: FraEuI1c_0714Help
Entry
FraEuI1c_0714     CDS       T01354                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
fri  Frankia sp. EuI1c
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FraEuI1c_0714
  Amino acid metabolism
   00300 Lysine biosynthesis
    FraEuI1c_0714
Enzymes [BR:fri01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     FraEuI1c_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899241..900311
Genome map
AA seq 356 aa AA seqDB search
MGLDVAVPAGELTGALVDFASVSGSEGPLADAVEAALVGLPGLTVDRDGDAVVARTSLGR
PTRVVLAGHLDTVPIADNVPSRREGDRLYGCGTSDMKSGVAVMLHLAATVAAESLVHDLT
WVFYDNEEVDASRNGLRRLAERHRDWLEGDLAVLMEPTGGEIEAGCQGTLRVIATLPGRR
AHSARSWLGDNAIHRAGDLLTRLAAYQPRTVEIDGCAYREGLSAVRISGGVAGNVIPDRC
EVTINFRFAPDRDVAGALAHVQEVLAGYELELTDSSGGALPGLSAPAAAAFVTATGRQPR
AKYGWTDVARFAALGIPALNYGPGDPNLAHTRDEYVELPLVEEAERVLRAYLTTRS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggacttgatgtcgcggtgccggcgggggagctgaccggggcgctggtggacttcgcg
tcggtgagcggttccgaggggccgctcgccgacgcggtcgaggcggcgctcgttggtctg
ccggggctgacggtcgaccgggacggcgacgcggtggtggcgcgcacgagcctcgggcgc
cccacccgggtggtgctcgcggggcatctcgacaccgtgccgatcgccgacaacgtgccg
tcgcgccgggagggcgaccggctctacgggtgcggcacgtccgacatgaagtccggcgtc
gccgtcatgctgcacctcgccgccaccgtggcggcggagtccctggtgcacgacctgacc
tgggtgttctacgacaacgaggaggtcgacgcctcccgcaacgggctgcgtcggctcgcc
gagcggcaccgggactggctggagggcgacctcgcggtcctgatggagcccacgggcggg
gagatagaggccggctgccagggaacgttgcgggtgatcgcgaccctgcccggccgccgc
gcccactcggcccgttcctggctcggggacaacgccatccaccgggccggagacctgctc
acccggctcgcggcctaccagccgcgcacggtcgagatcgacggctgtgcctaccgggag
gggctgtccgccgtgcggatctcgggtggtgtcgccggcaacgtcatcccggaccggtgc
gaggtgacgatcaacttccggttcgccccggaccgggacgtcgccggcgccctggcccac
gtccaggaggtgctcgcgggctacgagctggagctcaccgacagctcgggcggcgccctg
ccgggcctgtcggccccggccgcggcggcgttcgtcaccgccacagggcgccagccccgg
gccaagtacggctggaccgacgtcgcccggttcgcggcgctcggcatcccggcgctcaac
tacggccccggcgacccgaatctcgcgcacacccgcgacgagtacgtcgagctgcccctg
gtcgaggaggcagagcgcgtcctgcgcgcctacctcaccaccaggtcatag

DBGET integrated database retrieval system