KEGG   Frankia sp. EuI1c: FraEuI1c_0924Help
Entry
FraEuI1c_0924     CDS       T01354                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FraEuI1c_0924
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FraEuI1c_0924
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FraEuI1c_0924
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FraEuI1c_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155665..1156849
Genome map
AA seq 394 aa AA seqDB search
MTTTTTSATTTSSARPVDGHTNGSAGVDIAGASNPFVGPGRAAPRTWRGIIEEYRDRLPL
PADAPVITLLEGGTPLVPAGHLSEVIGCDVHLKVEGANPTGSFKDRGMTMAISAAAGEGS
KAVICASTGNTSASAAAYAARAGMICAVLVPSGKIALGKMAQALVHGSRLLQLDGSFDDC
LRVARELAEAYPVTLVNSVNPLRLEGQKTASFEIVEALGAAPDIHCLPVGNAGNITAYWR
GYLEADKEAGTGRPRMFGFQAAGAAPIVRGSVVTSPQTIATAIRIGNPASWDFAVDARDS
SGGLIDAVNDRQILAAYRLLARTEGVFVEPSSAASVAGLLAAHEAGKIDPGQRIVCTVTG
NGLKDPDWAISGAAKPETIRPTVAGAAEALGLRQ
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgaccacgtcagccacgaccacgtcatcggcgcggccggtggacgggcac
acgaacgggagcgcaggagtggacatcgcgggtgcgtcgaacccgttcgtcgggccgggc
cgcgccgcgccccgaacctggcgcgggatcatcgaggagtaccgcgaccggctgccgctg
cccgcggacgccccggtcatcaccctgctggagggcggcaccccgctcgtccccgccggc
cacctgtccgaggtcatcggctgcgacgtgcacctgaaggtcgagggcgcgaacccgacc
ggctccttcaaggaccgcggcatgacgatggcgatcagcgccgcggccggcgagggctcg
aaggccgtcatctgcgcgtccaccggcaacaccagcgcctccgcggcggcctacgcggcc
cgggccgggatgatctgcgccgtcctggtccccagcgggaagatcgcgctgggcaagatg
gcccaggcgctcgtgcacgggtcccggctgctgcagctcgacggctcgttcgacgactgc
ctgcgggtggccagggaactggccgaggcctacccggtgacgctggtcaactcggtcaac
ccgctgcggctggagggccagaagaccgcgtccttcgagatcgtcgaggcgctcggggcg
gcccccgacatccactgcctgccggttgggaacgcgggcaacatcaccgcctactggcgc
ggctacctggaggcggacaaggaggccggcaccggccggccgcggatgttcgggttccag
gcggccggcgcggccccgatcgtgcgcggcagcgtcgtcacctcgccgcagacgatcgcg
accgcgatccggatcggcaacccggcctcctgggacttcgccgtcgacgcgcgtgactcg
tccggcgggctgatcgacgcggtgaacgaccggcagatcctggccgcctaccggctgctc
gcccgcaccgagggcgtgttcgtcgagccgtccagcgccgcgagcgtcgccgggctgctc
gccgcgcacgaggccggcaagatcgacccgggccagcggatcgtctgcacggtcaccggc
aacggtctgaaggacccggactgggcgatcagcggcgcggccaagccggagacgatccgg
ccgaccgtcgccggcgcggccgaggcgctcgggctgcggcagtga

DBGET integrated database retrieval system