KEGG   Frankia sp. EuI1c: FraEuI1c_0949Help
Entry
FraEuI1c_0949     CDS       T01354                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
fri  Frankia sp. EuI1c
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FraEuI1c_0949
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FraEuI1c_0949
Enzymes [BR:fri01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     FraEuI1c_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1182148..1183407
Genome map
AA seq 419 aa AA seqDB search
MTGGCQLAGEVLIPGAKNSVLKLMAASLLAPGVTTLSAVPEILDVDVMADVLTTLGATVH
RDVATGTMTIDTPVTPGAAADPDLVRRIRASVAILGPLVGRCGEARVALPGGDAIGSRAL
DMHVNGLRRLGAVVDIEDGVLVARSSGRLQGAAIWLDFPSVGATENLLMAGVLAKGTTVV
DNAAREPEIADLCQFLTEMGARIEGIGGSTLVIEGVDELRPATHETVPDRIVAGTYAIGA
VMTRGDVFIRNGRAEHLGIVLEKLSAAGAIVDVGGDGFRVSMDDRPRSIDVVTLPYPGFP
TDLLPQIIALEAVSQGVSLITENVFDSRFVFCRELLRLGAQLRTDGHHVVVRPATQLVGA
SVSASDVRAGAGLVLAGLVADGITEVHEVHHIDRGYAGFVENLRALGADIRRERDAVAA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcggatgtcagctggcgggtgaggtcctcatcccgggggcgaagaactcggtc
ctgaagctcatggccgcgagcctgctggcgcccggggtgacgaccctgtccgcggtgccc
gagatcctcgacgtggacgtcatggccgacgtgctgaccacgctcggcgccaccgtgcac
cgtgacgtcgccacggggacgatgaccatcgacaccccggtcaccccgggcgcggccgcc
gatcccgatctggtgcgccggatccgggcctcggtggccatcctgggcccgctcgtgggc
cgctgcggcgaggcgcgggtcgcgctgcccggcggcgacgcgatcggctcgcgggcgctg
gacatgcacgtcaacggcctgcgccggctcggcgcggtggtcgacatcgaggacggggtc
ctggtcgcccgttcgtccggccggctgcagggcgcggccatctggctggacttcccgagt
gtcggcgcgaccgagaacctgctcatggcgggggttctcgcgaaggggacgacggtcgtc
gacaacgccgcgcgtgagccggagatcgccgacctgtgccagttcctgaccgagatgggc
gcgcggatcgagggcatcggcggttcgacgctggtcatcgagggcgtcgacgagctgcgg
cccgccacccacgagacggtgccggaccggatcgtcgccggcacctacgcgatcggcgcc
gtcatgacccgaggcgacgtcttcatccgcaacggccgggccgagcatctcggcatcgtg
ctggagaagctgtccgccgccggagccatcgtcgacgtcggcggcgatgggttccgggtc
tcgatggacgaccggccccgctccatcgacgtggtgacgctgccctacccggggttcccg
accgacctgctgccgcagatcatcgccctggaggcggtcagccagggtgtctcgctgatc
accgagaacgtgttcgacagccgcttcgtgttctgccgcgagctgctgcggctgggagcg
cagctgcggaccgacgggcaccatgtggtggtccgcccggccacccagctcgtcggcgcc
tcggtgtccgcctcggacgtgcgggcgggcgccggcctggtgctggccggactggtcgcg
gacggcatcaccgaggtccacgaggtgcatcacatcgaccgcggctacgcgggcttcgtg
gagaacctgcgcgcgctcggcgcggacatccgccgcgagcgcgacgccgtcgccgcctga

DBGET integrated database retrieval system