KEGG   Frankia sp. EuI1c: FraEuI1c_1045Help
Entry
FraEuI1c_1045     CDS       T01354                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
fri  Frankia sp. EuI1c
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FraEuI1c_1045
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FraEuI1c_1045
Enzymes [BR:fri01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     FraEuI1c_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1319164..1320606)
Genome map
AA seq 480 aa AA seqDB search
MPHTSPIDDLPADVPDQRPVQAPAAGSSLSFATAGDRHRYRIVGGQPLFGSVEVSGAKNS
VTKLLVATLLTDEPCTLARVPRIVEVDVVLGMLAELGAEVEWLDDHRVRIQTARITDPSL
SEMYSGVNRIPILMMGPLLHRVGEAVVPLPGGCRIGKRPVDFHLTGLRAMGAEIVEQLRS
VQVKTLGLHGAHVELPFPSVGATENLLLAAVRAKGTTVISNAAVEPEVIDLILFLQQMGA
LVDVEVDRTIVVQGVERLHGADHTAIPDRIEVASFAAAAVATDGRVDVRGARQEHVATFL
NHLRRIGGEFRVTDDGITFYKDRELTATHVQTDVHPGYMTDWQQPLVVLLTQAQGASVVH
ETIYEDRFGYTRQLNAMGASIALSTNCLGGKACRFAARDFEHSAVVSGPTPLVGGDLEIP
DLRAGFAYVLAALVAGGASTISGTRFLERGYEDPVGKLRSIGAMIETIPVAGPTQSGAAV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgccccatacctccccgatcgacgacctcccagcagacgtccccgaccaacggccggtc
caggcgcccgccgccggcagctcgctgagcttcgcgacggccggggaccggcaccgttac
cggatcgtcggcggtcagccgctgttcggctcggtcgaggtgtccggggcgaagaactcg
gtcacgaagctgctggtcgccaccctgctgacggacgagccctgcaccctggcccgggtg
ccgcggatcgtcgaggtcgacgtcgtgctcggcatgctggccgagctcggcgccgaggtg
gaatggctggacgaccaccgggtccggatccagaccgcgcggatcaccgacccgtccctc
tcggagatgtactccggggtgaaccggatcccgatcctgatgatgggcccgctgctgcac
cgggtcggcgaggcggtcgtgccgctgcccggcggctgccggatcggcaaacgcccggtc
gacttccacctcaccggcctgcgggcgatgggcgccgagatcgtcgagcagcttcgctcg
gtccaggtcaagacgctcggcctgcacggcgcccacgtcgagctgccgttcccgagcgtc
ggcgccaccgagaacctgctgctcgcggccgtccgagccaagggcaccacggtgatctcc
aacgcggcggtcgagccggaggtcatcgacctcatccttttcctgcagcagatgggcgcg
ctcgtcgacgtcgaggtcgaccgcacgatcgtcgtccagggcgtcgagcggctgcacggc
gcggaccacaccgcgatcccggaccgcatcgaggtcgcctcgttcgccgcggccgctgtc
gccaccgacggccgggtcgacgtcaggggcgcccgccaggagcacgtcgccacgttcctg
aaccacctgcgccggatcggcggggagttccgggtcaccgacgacgggatcaccttctac
aaggaccgcgagctgaccgccacgcacgtccagaccgatgtgcaccccgggtacatgacc
gactggcagcagcccctcgtggtgctgctgacgcaggctcagggcgcctcggtggtccac
gagaccatctacgaggaccggttcggctacacccgccagctcaacgccatgggcgcgagc
atcgcgctgtcgacgaactgcctgggcggcaaggcctgccggttcgcggcccgggacttc
gagcactccgctgtcgtgtcaggaccgacgccgctggtcggcggcgacctggagatcccc
gacctgcgggccggcttcgcctacgtgctggccgctctcgtcgcgggcggcgcgagcacc
atctcgggaacccgcttcctggagcgtggctacgaggacccggtcggcaagctgcgctcg
atcggcgccatgatcgagacgatccccgtggccgggcccacccagtccggcgccgccgtc
tag

DBGET integrated database retrieval system