KEGG   Frankia sp. EuI1c: FraEuI1c_1118Help
Entry
FraEuI1c_1118     CDS       T01354                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
fri  Frankia sp. EuI1c
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FraEuI1c_1118
Enzymes [BR:fri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     FraEuI1c_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1397097..1399538
Genome map
AA seq 813 aa AA seqDB search
MPGAMDVAATDRAESGAASLTDAEAALLDAYWRAANYLSVGQIYLLDNPLLREPLAAEHI
KPRLLGHWGTTPGLNLIYAHLNRVIKARDLDMMYVIGPGHGGPGIVANAYLEGTYSEVYP
TISGDEAGMRRLFRQFSFPGGIPSHVAPETPGSIHEGGELGYALAHAYGAAFDNPELVVA
AVVGDGEAETGPLAASWHSNKFLDPARDGAVLPILHLNGYKIAQATLLARIPEAELDALM
RGYGYAPLHVTADLDDDPAEVHRRFAAVLDQALDEIARIQRAARASAAAGEDVDRPAWPM
IIMRTPKGWTGPRAVDGKPVEGTWRAHQVPLTEVRTHPDRIAALAAWLASYRPHELFDAT
GRLRPELAALAPAGRSRMSASPHANGGELLRELALPDFRDYAVDVRAPGTTETSATTVLG
ALLRDVIRGNPSNFRLVGPDETASNRLGAVFEVTDRVWEGSLLPTDEHLARAGRVMEVLS
EHLCQGWLEGYLLTGRHGLFSCYEAFIHIVDSMVNQHAKWLKTTREIPWRRPIASLNYLL
TSHVWRQDHNGFSHQDPGFIDHVVNKKAEVVRVYLPPDTNTLLSVADHCLRSRDYINVIV
AGKQPALNYLTMDQAIAHCTRGLGIWDFASNDHDDASPGADGLPDVVLACAGDVPTLETL
AAVDLLRQHLPRLRIRVVNVVDLMALQSESEHPHGISDARFDALFTADRPVIFAYHGYPW
LIHRLTYRRANHHNIHVRGYIEEGTTTTPFDMVMMNGLDRFHLVADVIDRVPSLGARAAH
VRQLMMDERLRVRAYTREHGEDPPEISDWVWPY
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtgccatggacgtcgcggctaccgaccgcgccgaatccggggccgcgagcctc
accgacgccgaggccgcgctgctggacgcctactggcgggcggcgaactacctgtcggtc
gggcagatctacctgctggacaacccgctgctgcgcgagccgctggcggccgagcacatc
aagccgcggctgctcggccactgggggacgaccccgggcctcaacctgatctatgcccac
ctcaaccgggtcatcaaagcccgggatctcgacatgatgtacgtgatcgggccggggcac
ggtgggcccggcatcgtcgccaacgcctacctggagggcacctactccgaggtctacccg
acgatcagcggggacgaggccgggatgcgtcggctgttccgccagttctcgttccctggc
gggatcccaagccatgtcgcaccggagacccccgggtcgatccacgagggcggcgagctg
ggctacgcgctggcgcacgcctatggcgcggccttcgacaacccggagctggtcgtcgcg
gccgtcgtgggtgacggcgaggccgagaccgggccgctggcggccagctggcactcgaac
aagttcctcgacccggcccgcgacggtgccgtcctgccgatcctgcacctcaacggctac
aagatcgcccaggcgaccctgctggcccggattccggaggccgagctggacgcgctcatg
cgcggctacggctacgccccgctgcacgtcaccgccgatctggacgacgacccggccgag
gtgcaccgccggttcgccgccgtgttggaccaggcgctcgacgagatcgcccgaatccag
cgggcggccagggcgagcgccgcggccggcgaggacgtcgaccgcccggcgtggcccatg
atcattatgcggaccccgaagggctggaccgggccgcgggccgtcgacggcaagccggtc
gaaggcacctggcgtgcgcaccaggttccgctcaccgaggtgcgcacgcatcccgaccgg
atcgccgcgcttgccgcctggctggcgagctaccggccgcacgagttgttcgacgcgacc
ggccggctgcgtccagagctggccgcactcgcgccggcgggccggtcgcggatgagcgcc
agcccgcacgccaacggcggtgagctgctgcgcgagctcgccctgcccgacttccgcgac
tacgccgtcgacgtccgcgcgcccggcaccacggagacgtccgcgacgacggtgctcggc
gccctgctgcgcgacgtgatccggggcaacccgtcgaacttccgcctggttgggccggac
gagacggcgtcgaaccggctgggcgccgtcttcgaggtcaccgaccgggtctgggaaggc
tcactgctgccgaccgacgagcatctcgcccgggccggccgggtgatggaggtgctgtcc
gagcacctgtgccagggctggctggagggttacctgctgaccgggcggcacgggttgttc
tcctgctacgaggcgttcatccacatcgtcgactcgatggtcaaccagcacgcgaaatgg
ctgaagaccacccgggagatcccgtggcgacggccgatcgcctcgctgaactacctgttg
accagccatgtctggcgccaggaccacaacggcttctcccatcaggatcccggcttcatc
gatcacgtcgtgaacaagaaggccgaggtcgtccgggtctacctgccgccggacacgaac
acgctgctctcggtcgccgaccattgtctgcgcagccgcgactacatcaacgtgatcgtg
gccggcaagcagcccgcgctgaactacctgaccatggaccaggcgatcgcccactgcacc
cgcggcctcggtatctgggacttcgccagcaacgaccacgacgacgcgtcgccgggcgcg
gacggcctgcccgacgtcgtgctggcctgtgcgggcgacgtgccgaccctggagacgctg
gccgcggtcgacctgctgcgccagcacctcccgcggctgcggatccgggtggtgaacgtc
gtcgacctgatggcgctgcagagtgagtccgagcatccgcacggcatctccgacgcccgg
ttcgacgcgttgttcacggcggaccgcccggtcatcttcgcctaccacggctatccctgg
ctgatccaccggctgacctaccggcgcgccaaccaccacaacatccacgtccgcggctac
atcgaggaaggcacgacgaccacgccgttcgacatggtgatgatgaacggcctcgaccgg
ttccacctggtcgccgacgtgatcgaccgggttccgtcgctcggcgcccgggcggcccac
gtccgccagctgatgatggacgagcgcctccgagtccgcgcctacacccgcgagcacggc
gaggacccgcccgagatcagtgactgggtctggccctactga

DBGET integrated database retrieval system