KEGG   Frankia sp. EuI1c: FraEuI1c_1199Help
Entry
FraEuI1c_1199     CDS       T01354                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:fri01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fri01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fri00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:fri00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fri00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504861..1505598
Genome map
AA seq 245 aa AA seqDB search
MSLDSHGRVPAGRIVLVRHGETEWSRSGRHTGRTDIPLTPDGERRAAALLPALRGFRFAL
VATSPRTRAIHTADLAGLFAAPVGGGPTHQRQGGPDGVRPAVADVAAREVWPDLAEWDYG
DLEGLTTPTIRETQPGWTIWTGRVPGGETAGQVAARADAVLARALPLLRDGDVALVGHGH
MSRVLIARWLGLDPARGASFLVEPASLTILEHERETRVLGSLNLRPSPPEARLDAFQPGA
SASAL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcttgacagccacggccgcgtacctgccggccggatcgtgctggtccggcacgga
gagacggagtggagcaggtcgggccgccataccggccgtaccgacattccgctcaccccc
gacggcgaacggcgcgcggccgcgctgctgccggcgctgcggggcttccggttcgcgctg
gtcgcgaccagcccgcgcacccgcgccatccacaccgccgatctggccggccttttcgcc
gcgcccgtaggtggcgggccgacgcaccagcgccagggcggccccgacggggtgcgcccg
gccgtggccgacgtggcggcgcgcgaggtctggcccgatttggccgagtgggactacggc
gacctggagggcctgaccacgccgacgatccgcgagacccagccgggctggacgatctgg
accggccgggtgcccggcggggagaccgccggccaggtcgccgcccgggccgacgcggtg
ctggcccgggcgctgccgctgctgcgcgacggtgacgtcgcactggtcggacacgggcac
atgtcgcgggtgctgatcgcgcgctggctcgggttggacccggcgcgcggcgcgtcgttc
ctggtggagccggcgagcctgaccatccttgagcacgagcgggagacccgggtcctcggt
tcgctcaacctgcggccgtcgccgccggaggccaggctggacgccttccagcccggcgcc
tccgcgtccgcgctatag

DBGET integrated database retrieval system