KEGG   Frankia sp. EuI1c: FraEuI1c_1199Help
Entry
FraEuI1c_1199     CDS       T01354                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_1199
   01230 Biosynthesis of amino acids
    FraEuI1c_1199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_1199
  Energy metabolism
   00680 Methane metabolism
    FraEuI1c_1199
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FraEuI1c_1199
Enzymes [BR:fri01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     FraEuI1c_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504861..1505598
Genome map
AA seq 245 aa AA seqDB search
MSLDSHGRVPAGRIVLVRHGETEWSRSGRHTGRTDIPLTPDGERRAAALLPALRGFRFAL
VATSPRTRAIHTADLAGLFAAPVGGGPTHQRQGGPDGVRPAVADVAAREVWPDLAEWDYG
DLEGLTTPTIRETQPGWTIWTGRVPGGETAGQVAARADAVLARALPLLRDGDVALVGHGH
MSRVLIARWLGLDPARGASFLVEPASLTILEHERETRVLGSLNLRPSPPEARLDAFQPGA
SASAL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcttgacagccacggccgcgtacctgccggccggatcgtgctggtccggcacgga
gagacggagtggagcaggtcgggccgccataccggccgtaccgacattccgctcaccccc
gacggcgaacggcgcgcggccgcgctgctgccggcgctgcggggcttccggttcgcgctg
gtcgcgaccagcccgcgcacccgcgccatccacaccgccgatctggccggccttttcgcc
gcgcccgtaggtggcgggccgacgcaccagcgccagggcggccccgacggggtgcgcccg
gccgtggccgacgtggcggcgcgcgaggtctggcccgatttggccgagtgggactacggc
gacctggagggcctgaccacgccgacgatccgcgagacccagccgggctggacgatctgg
accggccgggtgcccggcggggagaccgccggccaggtcgccgcccgggccgacgcggtg
ctggcccgggcgctgccgctgctgcgcgacggtgacgtcgcactggtcggacacgggcac
atgtcgcgggtgctgatcgcgcgctggctcgggttggacccggcgcgcggcgcgtcgttc
ctggtggagccggcgagcctgaccatccttgagcacgagcgggagacccgggtcctcggt
tcgctcaacctgcggccgtcgccgccggaggccaggctggacgccttccagcccggcgcc
tccgcgtccgcgctatag

DBGET integrated database retrieval system