KEGG   Frankia sp. EuI1c: FraEuI1c_1482Help
Entry
FraEuI1c_1482     CDS       T01354                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fri  Frankia sp. EuI1c
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1840449..1841699)
Genome map
AA seq 416 aa AA seqDB search
MSNARVEPGPADDDRAGARRAAMVQRLRELGAVRGEDVARAFSTVPRHLFAPGASLEAAY
APENTVLVRRDDTGALVSTVSAPHIQAMMLEQVQVRPGMRVLEVGSGGYNAALLAELVGP
SGAVTTVDIDPEVVDRARSCLAAAGYDQVTVVLADADAGVPDRAPFDLVLVTTGMWDIPP
AFTDQLAPGGRLVIPLRLRGLTRSVVFESAGGRLVSRGYELCSFVPVRGVGAHPDEVIRL
DGDDAAIRFEDPPDADPVLVRQAVSWPRVEVWSSASVGEDGSFEGLLLWLATGLDNFGLL
MARPAAVARGVVGHAWPLGIPTIVGKGSFAYLALSPKAPGQTSREFGVYAHGPDAEALAE
RMAARIRTWDGGSLTARIEAFPADAPDLVLPAGAVVLDRRHRRLAVSWPTATDLPN
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcccgagtggaacccggccccgctgacgacgaccgagccggagcgcggcga
gcggcgatggtccagcggctgcgcgagctgggcgccgtgcgcggcgaggacgtggcgcgg
gcgttctcgacggtgccccggcacctgttcgcgccaggcgcgagcctcgaagcggcgtac
gcgccggagaacacggtgcttgtgcggcgggacgacaccggagcgctggtcagcacggtc
tcggcgccgcacatccaggcgatgatgctggagcaggtacaggtccggcccgggatgcgg
gtcctcgaagtgggcagcggcggctacaacgcggcgttgctcgcggagctggtcgggccg
tcgggcgcggtgacgacggtcgacatcgacccggaggtcgtcgaccgggcgcgcagctgt
ctggccgccgccggctacgaccaggtgacggtcgtgctcgcggacgccgacgccggtgtc
ccggaccgggcgccgttcgacctggtgttggtgaccaccgggatgtgggacatcccgccc
gcgttcaccgaccagctcgcgcctggcggccgtctggtcatcccgctgcggctgcggggg
ctcacgcggtcggtggtgttcgagtccgccggcggccggctggtgagccggggttatgag
ctgtgcagcttcgtccctgtgcgcggggtgggcgcccaccctgacgaggtgatccgcctc
gatggtgacgatgcggcgatccggtttgaggatccgccggacgccgacccggtcttggtc
cgtcaggcggtgtcctggccgcgggtcgaggtctggtcgagtgccagcgtcggcgaggac
gggtcgttcgagggcctgctgctgtggctggcgaccgggctcgacaacttcgggctgctc
atggcccggccggcagccgtcgcgcgcggcgtcgtcggccacgcctggccgctgggcatc
ccgacgatcgtcggcaagggcagcttcgcctacctcgcgctcagcccgaaggccccgggc
cagacgtcgcgtgagttcggcgtgtacgcacacggcccggacgccgaggcgctcgccgag
cggatggccgcccgcatccgaacctgggacggcggcagcctcaccgcgcgcatcgaagcc
ttccccgccgacgcccctgacctcgtgcttcccgcaggtgccgtggttctcgaccggcga
caccggcgactggccgtctcctggccgaccgccaccgatcttccgaactga

DBGET integrated database retrieval system