KEGG   Frankia sp. EuI1c: FraEuI1c_1678Help
Entry
FraEuI1c_1678     CDS       T01354                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
fri  Frankia sp. EuI1c
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fri00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fri00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2056909..2057928
Genome map
AA seq 339 aa AA seqDB search
MNRHLLSTANLSRDDALLILDTAEQMARLADRSVKKLPTLRGRTVVNLFFEDSTRTRTSF
EVAAKRLSADVINFSAKGSSVSKGESLKDTAQTLEAMGADAVVIRHPASGAPHRLAGWVR
GTVLNAGDGTHEHPTQALLDAFTMRRRLGRVDGLAVTIVGDVLHSRVARSNVWLLRTLGA
KVTLVAPPTLLPHAVASWPVEVSYDLDAVLPASDVVMMLRVQRERMSDAFFPTEREYSRR
YGLDADRAAKLPDHALVMHPGPMVRGMEIASDVADSVRSTVVEQVANGVSVRMACLYLLL
GGADGPGDERSGDQRPRDQRPGDQEAPEHRPHEQREVSR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgccacctgctgagcaccgccaacctcagccgcgacgacgcgctgctcatcctc
gacacggccgagcagatggcgcgcctcgccgaccggtcggtgaagaaactgccgaccctg
cgcggccggaccgtcgtcaaccttttcttcgaggactcgacccgcacccgcacgtcgttc
gaggtcgcggccaagcgcctgtccgccgacgtcatcaacttctccgccaagggctccagc
gtctccaagggcgagagcctcaaggacaccgcgcagaccctggaggcgatgggcgccgac
gcggtggtcatccgccaccccgcctccggagcgccgcaccggctggccggctgggtccgc
ggcaccgtgctcaacgccggcgacggcacccacgagcacccgacccaggcgctgctggac
gcgttcacgatgcgccggcggctcggccgggtcgacgggctcgcggtgacgatcgtcggc
gacgtcctgcactcgcgggtggcccggtcgaacgtctggctgctgcgcacgctcggcgcg
aaggtgacgctggtcgccccgccgacgctgctgccgcacgcggtggcgagctggccggtc
gaggtgtcctatgacctggacgcggtgctgccggcgtcggacgtcgtgatgatgctgcgg
gtgcagcgggaacggatgtccgacgctttcttcccgaccgagcgggagtacagccgtcgc
tacggcctggacgccgaccgggcggcgaagctgcccgaccacgcgctcgtcatgcacccg
ggaccgatggtgcgcggcatggagatcgcctccgacgtggccgactcggtgcgctcgacg
gtcgtcgagcaggtggcgaacggcgtcagcgtccggatggcctgcctctacctgctgctg
ggcggcgcggacggccccggcgacgaacggtccggcgaccagcggccccgtgaccagcga
cccggtgaccaggaagcacccgagcaccggccacacgagcagcgggaggtctctcgatga

DBGET integrated database retrieval system