KEGG   Frankia sp. EuI1c: FraEuI1c_1685Help
Entry
FraEuI1c_1685     CDS       T01354                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fri  Frankia sp. EuI1c
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fri00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2067419..2067964
Genome map
AA seq 181 aa AA seqDB search
MGLTVLSGPSGVGKGTVVAAVRRLFPDVWVSVSATTRLPRPGETEGVEYHFVDRDHFVRM
AKDGELVEHAEFAGNWYGTPRAPLERRLTTGLPALLEIELQGARQVRASMPSARFVFLTP
PSWEELVRRLTGRGTEPPEVIERRLDRARVELAAEKEFDAVVVNDDVEAAAARLVSLMTD
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccgtcttgtccgggccgtccggggtgggcaaaggaaccgtcgtcgccgcc
gtgcgccggcttttccccgatgtctgggtatcggtgagcgcgacgacccgcttgccccgc
ccgggtgagaccgagggcgtcgagtaccacttcgtcgaccgggaccacttcgtgcggatg
gccaaggacggcgagctggtcgagcacgccgagttcgccggcaactggtacggcacccca
cgcgcgccgctggagcggcggctcaccaccgggctgcccgcgctgctggaaattgagctg
caaggtgcccgtcaggtccgcgcgtcgatgccgtccgcccgcttcgtctttctcaccccg
cccagctgggaggagctcgtccgccggctgaccggccggggcaccgagccgcccgaggtc
atcgagcgccggctcgaccgggcccgcgtcgagctggccgccgagaaggagttcgacgcg
gtcgtcgtcaacgacgacgtcgaggccgccgcggcgcggttggtatccttgatgactgac
tcatga

DBGET integrated database retrieval system