KEGG   Frankia sp. EuI1c: FraEuI1c_1768Help
Entry
FraEuI1c_1768     CDS       T01354                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fri  Frankia sp. EuI1c
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_1768
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FraEuI1c_1768
  Amino acid metabolism
   00310 Lysine degradation
    FraEuI1c_1768
Enzymes [BR:fri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FraEuI1c_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2177179..2178621)
Genome map
AA seq 480 aa AA seqDB search
MSVSVTMPRLGESVSEGTVTRWLKQEGEHVEADEPLLEVSTDKVDTEIPAPASGVLSSIK
VAEDETVEVGVELAVIEDGAAAPAAAPALAAAAAPAPAPAPAPAPTPPPAPTPPPAPVAA
APPPAPVTPPPAPAPAPAPVPVAQAPAPVTTAASNGEARYVTPLVRKMAAELGVDLGTVK
GTGPGGRISKQDIVDASKAAPAAAPAPAPAAAPAPVASAPAPAAAPAPVAAKAPVAPVPA
LRGRTEKLSRLRTVIAKRMVESLQVSAQLTTVVEADVTKIARLRNHAKDAFYAREGVKLS
FLPFFAIAACEALREHPVLNSSVDTAAGTITYYDVEHLGIAVDTERGLTVPVIHNAGDLN
LSGMARKIDDLAKRTRANQVSPDELSGGTFTLTNTGSRGALFDTPILNQPQVGILGTGTV
VKRPAVVEDPNLGEVIAVRSTVYLALTYDHRIVDGADAARFLTTVKARLEEGSFEAELGL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtatccgtcacgatgccccgcctgggcgagagcgtgtccgagggcacggtcacc
cggtggctcaagcaggagggcgagcacgtcgaagccgacgagccgctccttgaggtcagc
accgacaaggtcgacaccgagatcccggcgcccgcgtccggcgtcctctcgtcgatcaag
gtcgccgaggacgagaccgtcgaggtcggcgtcgagctcgcggtgatcgaggacggtgcg
gcggctcccgctgccgcgccggcattggccgcggcggccgctcccgcgcctgcgcccgcc
ccggctcccgctcccacgccgccgccggctcccactcccccgccggcgcccgtcgcggcc
gctccgccgcccgcgcccgtcactccgccgcccgcgccggcgccggcgccggctcccgtg
ccggtcgctcaggctcccgcgccggtgaccaccgccgcgtccaacggcgaggcccgttac
gtcaccccgctggtccgcaagatggccgccgagctgggtgtcgacctgggcacggtcaag
ggcaccggccccggcggccggatcagcaagcaggacatcgtcgacgcgtccaaggccgcc
ccggccgccgcgccggctcccgcccccgccgcggccccggcgccggttgccagcgcgccg
gcccctgccgcggcgccggcgcccgtcgccgccaaggctccggtcgcgcccgttccggcc
ctgcgcggcaggaccgagaagctctcccggctgcgcaccgtcatcgccaagcggatggtc
gagtcgctgcaggtcagcgcccagctgaccaccgtcgtcgaggccgacgtcaccaagatc
gccaggctgcgtaaccacgcgaaggacgcgttctacgcccgtgagggcgtgaagctgtcg
ttcctgccgttcttcgcgatcgccgcctgcgaggcgctgcgcgagcacccggtgctgaac
tccagcgtcgacaccgccgccggcacgatcacctactacgacgtcgagcacctcggcatc
gcggtggacaccgagcgtggcctgaccgttccggtcatccacaacgccggggacctgaac
ctctccggcatggcccgcaagatcgacgacctggccaagcgcacccgcgcgaaccaggtc
tcgccggacgagctcagcggcggcacgttcaccctgaccaacaccggcagccgcggcgcc
ctgttcgacaccccgatcctcaaccagccgcaggtcggcatcctgggcaccgggaccgtc
gtgaagcggccggccgtcgtcgaggacccgaacctcggcgaggtcatcgcggtgcgttcc
acggtctacctcgcgctgacctacgaccaccggatcgtcgacggcgccgacgcggcccgt
ttcctgaccacggtgaaggcccgcctcgaagagggctccttcgaggccgaactcggcctc
tga

DBGET integrated database retrieval system