KEGG   Frankia sp. EuI1c: FraEuI1c_1768Help
Entry
FraEuI1c_1768     CDS       T01354                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fri  Frankia sp. EuI1c
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_1768
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FraEuI1c_1768
  Amino acid metabolism
   00310 Lysine degradation
    FraEuI1c_1768
Enzymes [BR:fri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FraEuI1c_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2177179..2178621)
Genome map
AA seq 480 aa AA seqDB search
MSVSVTMPRLGESVSEGTVTRWLKQEGEHVEADEPLLEVSTDKVDTEIPAPASGVLSSIK
VAEDETVEVGVELAVIEDGAAAPAAAPALAAAAAPAPAPAPAPAPTPPPAPTPPPAPVAA
APPPAPVTPPPAPAPAPAPVPVAQAPAPVTTAASNGEARYVTPLVRKMAAELGVDLGTVK
GTGPGGRISKQDIVDASKAAPAAAPAPAPAAAPAPVASAPAPAAAPAPVAAKAPVAPVPA
LRGRTEKLSRLRTVIAKRMVESLQVSAQLTTVVEADVTKIARLRNHAKDAFYAREGVKLS
FLPFFAIAACEALREHPVLNSSVDTAAGTITYYDVEHLGIAVDTERGLTVPVIHNAGDLN
LSGMARKIDDLAKRTRANQVSPDELSGGTFTLTNTGSRGALFDTPILNQPQVGILGTGTV
VKRPAVVEDPNLGEVIAVRSTVYLALTYDHRIVDGADAARFLTTVKARLEEGSFEAELGL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtatccgtcacgatgccccgcctgggcgagagcgtgtccgagggcacggtcacc
cggtggctcaagcaggagggcgagcacgtcgaagccgacgagccgctccttgaggtcagc
accgacaaggtcgacaccgagatcccggcgcccgcgtccggcgtcctctcgtcgatcaag
gtcgccgaggacgagaccgtcgaggtcggcgtcgagctcgcggtgatcgaggacggtgcg
gcggctcccgctgccgcgccggcattggccgcggcggccgctcccgcgcctgcgcccgcc
ccggctcccgctcccacgccgccgccggctcccactcccccgccggcgcccgtcgcggcc
gctccgccgcccgcgcccgtcactccgccgcccgcgccggcgccggcgccggctcccgtg
ccggtcgctcaggctcccgcgccggtgaccaccgccgcgtccaacggcgaggcccgttac
gtcaccccgctggtccgcaagatggccgccgagctgggtgtcgacctgggcacggtcaag
ggcaccggccccggcggccggatcagcaagcaggacatcgtcgacgcgtccaaggccgcc
ccggccgccgcgccggctcccgcccccgccgcggccccggcgccggttgccagcgcgccg
gcccctgccgcggcgccggcgcccgtcgccgccaaggctccggtcgcgcccgttccggcc
ctgcgcggcaggaccgagaagctctcccggctgcgcaccgtcatcgccaagcggatggtc
gagtcgctgcaggtcagcgcccagctgaccaccgtcgtcgaggccgacgtcaccaagatc
gccaggctgcgtaaccacgcgaaggacgcgttctacgcccgtgagggcgtgaagctgtcg
ttcctgccgttcttcgcgatcgccgcctgcgaggcgctgcgcgagcacccggtgctgaac
tccagcgtcgacaccgccgccggcacgatcacctactacgacgtcgagcacctcggcatc
gcggtggacaccgagcgtggcctgaccgttccggtcatccacaacgccggggacctgaac
ctctccggcatggcccgcaagatcgacgacctggccaagcgcacccgcgcgaaccaggtc
tcgccggacgagctcagcggcggcacgttcaccctgaccaacaccggcagccgcggcgcc
ctgttcgacaccccgatcctcaaccagccgcaggtcggcatcctgggcaccgggaccgtc
gtgaagcggccggccgtcgtcgaggacccgaacctcggcgaggtcatcgcggtgcgttcc
acggtctacctcgcgctgacctacgaccaccggatcgtcgacggcgccgacgcggcccgt
ttcctgaccacggtgaaggcccgcctcgaagagggctccttcgaggccgaactcggcctc
tga

DBGET integrated database retrieval system