KEGG   Frankia sp. EuI1c: FraEuI1c_1816Help
Entry
FraEuI1c_1816     CDS       T01354                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
fri  Frankia sp. EuI1c
Brite
Enzymes [BR:fri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     FraEuI1c_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2230254..2231099
Genome map
AA seq 281 aa AA seqDB search
MAAADRGRGAGAPAGAPLLPGAAPFELGAGGPVGVLLVHGFTGTPQSLRQWGDFLAAAGL
TVRCPLLPGHGTRWQDMAQTGWRDWYGAVDEAFGDLRARCDQVFVMGLSMGGTLTLRLAE
ERGAEVAGAVTVNPSLGTDRRVARLAPLIARVRPSIPGIASDIKATGAREVGYDRVPVRA
FVSLMELWKVTLPDLPRIVSPVLTFRSVIDHVVEPSSGRLLLAGMTAAPVTERLLPDSYH
VATLDNDRQAIFEGSLEFLRAHAAAPAPGAAAAPGVADVDV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgccgaccggggccgtggcgcgggagcgccggcgggtgcccccctgttgccc
ggtgccgcgcccttcgagctgggagccggcggccccgtcggggtgctgctggtgcacggc
ttcaccggaacgccccagagcctgcggcagtggggcgacttcctcgcggccgccgggctc
acggtgcgctgcccgctgctgcccggccacggcacccgctggcaggacatggcccagacc
ggctggcgcgactggtacggcgcggtcgacgaggcgttcggcgacctgcgcgcccgctgc
gaccaggtgttcgtgatgggcctgtcgatgggcggcacgctgacgctgcggctggccgag
gagcgtggcgcggaggtggccggcgccgtcaccgtgaaccccagcctcggcaccgaccgg
cgggtcgcgcggctcgccccgctgatcgcccgggtgcgcccgtcgatccccggcatcgcc
agcgacatcaaggcgaccggtgcccgcgaggtcggctatgaccgggtgccggtccgggcg
ttcgtgtcgctcatggagctgtggaaggtcaccctgccggacctgccccggatcgtcagc
ccggtgctgaccttccgcagcgtcatcgaccacgtcgtcgagcccagctccgggcgtctg
ctgctcgccgggatgaccgcggcgcccgtcaccgaacggctgctgccggacagctaccac
gtcgccaccctcgacaacgaccggcaggcgatcttcgagggcagcctggagttcctccgc
gcccacgccgccgcgccggctcctggcgccgcggccgcgcccggggtcgctgacgtcgat
gtctga

DBGET integrated database retrieval system