KEGG   Frankia sp. EuI1c: FraEuI1c_1885Help
Entry
FraEuI1c_1885     CDS       T01354                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    FraEuI1c_1885
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_1885
  Lipid metabolism
   00071 Fatty acid degradation
    FraEuI1c_1885
  Amino acid metabolism
   00350 Tyrosine metabolism
    FraEuI1c_1885
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FraEuI1c_1885
   00626 Naphthalene degradation
    FraEuI1c_1885
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FraEuI1c_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2302837..2303901)
Genome map
AA seq 354 aa AA seqDB search
MTSSGGMPAYRITAWLRPPHLVEAPVPMPGPGEVLVAVAANGLCHSDLTMSQIPGEIGDL
IGWRVPFTLGHEIAGTIVEAGPDAADAPAVGTAVALVSPTSCGRCAYCLAGRDSACPNGL
AGRGYGRDGGLAPYVVAPVRALIPLNGLDPVAAAPLTDAGATSYHAVRRVLPVLEPGSTA
VVLGAGGLGGFAIQHLKACSPARVVAVDVSPARLATAAELGADETLPGVGDDPGATTGAL
RELTGGDGAAAVLDFVGTDTTITAGIGAVRPCGAFGLVGSAGGRLRAGWYGGLPREAEVF
TFQGSTIADAHAVVALAAAGRIRSLVEVFTLDQVADAYRALDEATLRGRAVVTP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctccggcggcatgccggcctaccggatcaccgcctggctgcggccgccacac
ctggtcgaggcgccggtgccgatgccgggtcctggcgaggtgctggtcgccgtggcggcc
aacgggctgtgccactcggacctgacgatgagccagattcccggcgagatcggcgacctg
atcggctggcgggtgccgttcaccctcggccacgagatcgccggcaccatcgtcgaggcc
gggccggacgccgcggacgcacccgccgtcggcaccgccgtcgcgctggtctcgccgacg
tcctgcggccggtgcgcctactgcctggccggccgggacagcgcctgcccgaacggcctc
gccggccggggctacggccgcgacggcgggctcgcgccgtacgtggtcgcgccggtccgt
gcgctgatcccgctgaacgggctcgacccggtagccgccgcgccgctgaccgacgccggc
gccacgtcctaccacgcggtccgccgtgtgctgccggtgctggagccgggcagcaccgcg
gtcgtgctgggcgcgggtgggctcggcggcttcgcgatccagcatctgaaggcctgctcc
ccggcccgcgtcgtcgccgtcgacgtctcccccgcccggctcgccacggcggcggagctg
ggcgcggacgagaccctgccaggcgtcggcgacgacccgggcgcgaccaccggcgcgctc
agggagctgaccggcggcgacggcgcggccgccgtgctcgacttcgtcggcaccgacacg
acgatcacggcgggcatcggcgccgtccgaccgtgcggcgcgttcggcctggtcggctcg
gccggcgggaggctgcgggccggctggtacggcggcctgccccgcgaggcggaggtcttc
accttccagggctcgacgatcgccgacgcgcacgccgtggtcgcgctggccgccgccggc
cgcatccgcagcctggtcgaggtcttcacgctcgaccaggtcgccgacgcctaccgcgcc
ctcgacgaggccaccctgcgcggccgcgcggtcgtcaccccctga

DBGET integrated database retrieval system