KEGG   Frankia sp. EuI1c: FraEuI1c_1975Help
Entry
FraEuI1c_1975     CDS       T01354                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fri  Frankia sp. EuI1c
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_1975
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FraEuI1c_1975
   00630 Glyoxylate and dicarboxylate metabolism
    FraEuI1c_1975
Enzymes [BR:fri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FraEuI1c_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2419361..2421049
Genome map
AA seq 562 aa AA seqDB search
MGATGESAGATDGVEVEREVAGLDASDAASLAADVLTDDAVAFVAGLQRAFGARRSELLA
NRARRRAAIAAGGSLDFLPETAEVRAGAWTVAPPAPDLADRRCEITGPTDAKMVINALNS
GARLFMADFEDANVPTWANLLDGQRNLTAAIAGTLSFTNPDGRVYRLVDRPATLVVRPRG
WHLPERHVMVDGAAVSGSLFDAGLYLFRNARTLAAAGRTPAFYLPKMESHLEARLWNDVF
GFAEDALRLAQGTIRATVLIETLPAAFEMDEILYELREHSAGLNAGRWDYLFSTIKTFAA
RPGEFLLPDRNAVTMTAPFLRAYTELLVSTCHRRGAHAIGGMAAFIPSRRDPAVNAAALA
KVRADKVRESGDGFDGSWVAHPDLVPVCTEVFDGVLGAAPNQLSRQRPDVHVTADALLDV
AATPGEITEQGVRINISVGLRYLETWLRGSGAVGIDNLMEDAATAEISRSQLYQWVAAGA
KLADGRVVTAELVRQILAEEVARLSPSGPVPDAEAGSLPGAGESAEAGKAGGRWADALEL
FEQTALGEPFAEFLTLPAYDRI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgacaggcgagtcagcgggcgcgacggacggcgtcgaggtcgagcgggaggtg
gccgggctcgacgcctcggacgcggcctcgctcgccgcggacgtgctcaccgacgacgcg
gtggcgttcgtcgccgggctgcagcgcgcgttcggcgcgcggcgctccgaactgctggcc
aaccgggcccggcggcgggccgcgatcgccgcgggcggatcgctggacttcctgcccgag
acggccgaggtccgcgccggcgcctggacggtcgccccacccgccccggatctggccgac
cgccgctgcgagatcaccggcccgacggacgcgaagatggtcatcaacgccctcaacagc
ggcgcccggctgttcatggcggacttcgaggacgccaacgtccccacctgggcgaacttg
ctcgacggccagcgcaacctcaccgcggcgatcgcgggcacgctgtccttcaccaacccg
gacggccgcgtctaccggctcgtcgaccggcccgcgaccctggtcgtccggccgcgcggc
tggcatctgcccgagcggcacgtcatggtcgacggcgccgccgtgtccggctcgctgttc
gacgccgggctctacctgttccgcaacgcgcggaccctcgcggcggccggccggaccccg
gcgttctacctgccgaagatggagagccacctcgaggcccggctgtggaacgacgtgttc
ggcttcgccgaggacgccctgaggctcgcccagggcaccatccgggccaccgtgctgatc
gagacgctcccggccgcgttcgagatggacgagatcctctacgagctgcgcgagcactcc
gccgggctcaacgcgggccgctgggactacctgttctccacgatcaagacgttcgccgcc
cggcccggcgagttcctcctgcccgaccgcaacgccgtgacgatgaccgcgccgttccta
cgggcgtataccgaactgctcgtctcgacctgccatcggcgcggcgcgcacgcgatcggt
ggcatggcggcgttcatcccgtcgcggcgcgaccccgcggtgaacgcggccgccctggcg
aaggtccgggccgacaaggtccgcgagtccggggacgggttcgacggcagctgggtcgcg
catcccgacctcgtccccgtctgcaccgaggtcttcgacggcgtcctgggcgccgcgccc
aaccagctcagccggcagcgccccgacgtccacgtcaccgccgacgcgctcctcgacgtc
gccgcgacccctggcgagatcaccgagcagggggtgcggatcaacatcagcgtcgggctg
cgctacctggagacctggttgcgcggctccggcgcggtcggcatcgacaacctgatggag
gacgcggccaccgcggagatctcgcgcagccagctctaccagtgggtcgccgccggcgcg
aagctcgccgacggccgggtcgtcaccgccgagctggtccgccagatcctcgccgaggag
gtcgctcggctgagcccgtcgggcccggtcccggacgcggaagcgggctctctgccgggc
gccggcgaatcggccgaggccggaaaggccggcgggcgatgggcggacgccctcgagctt
ttcgagcagaccgcgctcggtgaacccttcgccgagttcctcacactgcccgcctacgac
cggatctga

DBGET integrated database retrieval system