KEGG   Frankia sp. EuI1c: FraEuI1c_2291Help
Entry
FraEuI1c_2291     CDS       T01354                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00860  Porphyrin and chlorophyll metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FraEuI1c_2291
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     FraEuI1c_2291
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     FraEuI1c_2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like Pyr_redox_2 FAD_binding_2 Pyr_redox AlaDh_PNT_C Thi4 FAD_binding_3 Trp_halogenase GIDA Pyr_redox_3 MCRA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADP80330
UniProt: E3IZ47
Position
2810120..2811553
Genome map
AA seq 477 aa AA seqDB search
MRVVIVGGGIAGLAAAHALAGKAEVTVLEAADRVGGKLRTTPIEGLAVEEGAESFLARVP
EGQRLARQVGLGHDLVHPATTSAALWIHGRLRPIPPNTLLGVPTDALGLIRSRVLSPFGL
LRAAADMVLPRAALPEDPTVGDFVGARVGRQIVDRLVDPLLGGVYAGRADALSLRATVPQ
LVPILAEDRSLLLGAHRVRARTAPVASTPPAPVFATVRGGLGGFAARVSEASGAAVRTGV
LVRRIARVEGGWRVDFDEKGAAGAPGDIVTGPRGSGSLDADAVILAVPAGAARDLLTPIA
PHAAAPLAGVPYASIGLVTLIYRDVDLPAGSSGFLVPPRERVTIKAATYLTSKWPHVSSG
GPLRVVRASVGRAGADEDLRRSDTELTGVVAAEIAHISGITARPVASRVSRWGGGLPQYL
PGHLERVASVRRALPPGLALAGAGYDGVGIPACIRSGEAAAAAVLSATDAVGAAGPV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtggtgatcgtcggtggcggcatcgcgggcctcgccgcggcgcacgcgctggct
ggcaaggcagaggtaaccgtgctggaggccgccgaccgggtcggcggcaagctgcgcacc
accccgatcgaggggctcgcggtcgaggagggcgccgagtcgttcctcgcccgcgttccg
gagggccagcggctggcccgccaggtcggcctcgggcacgacctcgtgcacccggccacg
acctcggccgcgttgtggatccacgggcggctgcggccgatcccgccgaacacgctgctc
ggcgtgccgaccgacgcgctcgggctgatccgctcccgggtgctgtccccgttcggcctg
ctgcgggcggccgccgacatggtgctgccgcgcgccgcgctccccgaggaccccaccgtc
ggcgacttcgtcggcgcccgggtcggccggcagatcgtcgaccggctggtggacccgctg
ctcggcggcgtctacgccggccgggccgacgccctgtcgctgcgggccaccgtcccgcag
cttgtcccgatcctggccgaggaccgctcgctgctgctcggcgcccaccgggtgcgggcg
cgtaccgccccggtcgcctccaccccgccggccccggtgttcgccaccgtgcgcggcggt
ctggggggcttcgcggcccgggtctccgaggccagcggcgccgccgtgcggaccggggtg
ctcgtgcgccggatcgcccgggttgagggcggctggcgggtcgacttcgacgagaagggc
gccgccggcgcgccgggcgacatcgtcaccgggccccgcggcagcggatcgctggacgcc
gacgcggtgatcctcgccgtgccggccggcgccgcccgggacctgctcaccccgatcgcc
ccgcacgccgccgcgccgctggccggcgtgccgtacgcgtcgatcggcctggtcacgctg
atctaccgggacgtcgacctgcccgcgggcagcagcggcttcctggtgccgccccgtgag
cgggtcaccatcaaggccgcgacctacctgacgtcgaaatggccgcacgtgtcctcgggc
ggcccgctgcgggtggtgcgcgccagcgtcgggcgggccggcgccgacgaggacctgcgc
cgttccgacaccgagctgaccggcgtggtcgccgccgagatcgcgcacatcagcgggatc
accgcccgcccggtcgccagccgggtcagccgctggggcggcggcctgccgcagtacctg
cccggccacctggagcgggtcgcctcggtgcgccgcgcgctgccgcccggcctcgcactg
gccggcgccggctacgacggcgtcggcatcccggcctgcatccgctcgggcgaggcggcc
gccgccgccgtgctcagcgcgaccgacgcggtcggcgccgccggcccggtctga

DBGET integrated database retrieval system