KEGG   Frankia sp. EuI1c: FraEuI1c_2300Help
Entry
FraEuI1c_2300     CDS       T01354                                 

Definition
ATP dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:fri03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:fri03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:fri03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:fri03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2821966..2823048)
Genome map
AA seq 360 aa AA seqDB search
MQLPVMPPVAPMLAKSVPTIPSGASYEPKWDGFRCICFRDGDEVELGSRNEKPMTRYFPE
LVEAIKAELPDRCVLDGEIVIALDGRLDFEALQQRIHPAVSRVKLLSGTTPASFIAFDLL
ALGDEDYTGRPFAERRAALEAALAPAKAPIHLTTTTTDLDVANRWFVELEGAHLDGVIAK
PLDGVYQPDKRVMFKIKHVRTADCVLAGFRWHKTSTEAAPLVGSLLLGLYNDEHKLQHVG
VVGAFTAKRRAELVDELAPLLLGDGDDHPWQEWASAEAHQGQRLPGNVNRWNAQKDLSFI
PLRPERVLEVKYEHMEGTRFRHLAHFVRWRADRTPASCTYEQLEQPLTYTLSDIVPGLGS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcccgtgatgccgccggtcgcgccgatgctggcgaagtcggttccgaccatc
ccgtccggggcgtcctatgagcccaaatgggacggcttccgatgcatctgtttccgggac
ggtgacgaggtcgagctcggcagccgcaacgagaagccgatgacccgctacttccccgag
ctggtcgaggcgatcaaagccgaactacccgaccggtgcgtcctcgacggcgagatcgtc
atcgctctggacggcaggctggacttcgaggcgttgcagcagcgcatccaccccgcggtg
tcgcgggtgaagctgttgagcgggacgaccccggcctcgttcatcgcattcgatctgctc
gcgctcggcgacgaggactacaccgggcgcccgttcgccgagcggcgcgccgcgctcgag
gccgcgttggccccggcgaaggcgccgatccacctcaccacgaccaccaccgacctcgac
gtcgccaaccgctggttcgtcgagctcgaaggcgcgcacctcgacggcgtgatcgccaaa
ccgctcgacggcgtctaccagcccgacaagcgcgtcatgttcaagatcaagcacgtccgc
accgccgactgcgtcctcgccggcttccgctggcacaagacctccacggaggctgccccg
ctcgtcggctcgctgctgctcgggctctacaacgacgagcacaagctgcagcacgtcggc
gtcgtcggtgccttcacggccaagcgccgggccgagctggtcgacgaactcgcgccgctc
ctgctcggcgacggcgacgaccatccgtggcaggagtgggccagcgccgaggcgcaccag
ggccagcggctgcccggcaacgtgaaccggtggaacgcgcagaaggacctgtcgttcatc
ccgctgcgtcccgagcgggtgctggaggtcaagtacgagcacatggagggcacccgcttc
cggcacctggcgcacttcgtccgctggcgcgccgaccgcacccccgcttcctgcacctac
gagcagcttgagcagccgctcacctacaccctctccgacatcgttcccggactcggctcg
tag

DBGET integrated database retrieval system