KEGG   Frankia sp. EuI1c: FraEuI1c_2329Help
Entry
FraEuI1c_2329     CDS       T01354                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fri  Frankia sp. EuI1c
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fri03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2856179..2856796
Genome map
AA seq 205 aa AA seqDB search
MIASVAGTVLSVSPTAAVVEVGGVGLLVQCTPATLAGLAVGEPARLATALVVRETELTLY
GFADADERDVYETLQGAAGVGPKLAQAVLGVLAPDEVRRAVADEDLAALTRVPGVGRKGA
QRIVLDLKDKLGPPVGGAPARQAAGGRVLPAPRTAPEQVTDALGGLGYSTREAEDAVAAV
LAGDGTDTDDVSAMLRAALAFLRPR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcggtcgcggggacggtgctgtcggtgtcgccgacggcggccgtcgtcgag
gtcggcggggtcgggctgctggtccagtgcaccccggcgacgctggccggcctggccgtc
ggcgagccggcccggctggcgaccgcgctggtggtccgcgagaccgagctgaccctctac
ggcttcgccgacgcggacgagcgcgacgtctacgagaccctgcagggcgcggccggcgtc
ggccccaagctcgcccaggcggtgctgggcgtgctcgcccccgacgaggtgcgccgggcc
gtcgcggacgaggacctggcggcgctgacgcgggtcccgggcgtcggccgcaagggcgcc
cagcgcatcgtgctcgacctcaaggacaagctcggcccgcccgtcggcggcgcgcccgcg
cggcaggccgccgggggccgggtcctgccggcgccgcgcacggcccccgagcaggtcacg
gacgcgctgggcgggctcggatactcgacccgggaggccgaggacgccgtggcggcggtg
ctggccggcgacggcaccgacaccgacgacgtgtcagccatgctgcgcgccgcgctcgcc
ttcctgcggccgcggtag

DBGET integrated database retrieval system