KEGG   Frankia sp. EuI1c: FraEuI1c_2369Help
Entry
FraEuI1c_2369     CDS       T01354                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fri  Frankia sp. EuI1c
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    FraEuI1c_2369
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FraEuI1c_2369
Enzymes [BR:fri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     FraEuI1c_2369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2912122..2913690
Genome map
AA seq 522 aa AA seqDB search
MTPPALRPAHRPARTLTELRALLADLGSVQRAAAADVAAPEVVLHGVTHDSRAVQPGDLY
AALPGSHAHGADFAAAAAASGAAAVLTDPAGAAALAGSVDLPVVTTADPRSDVAQVADWL
YGQPSRSLTLLGVTGTNGKTTSAFLVDAGLRAAGHRTGLLGTVETRIADERVDSVRTTPE
SSDLQALFAVMVERGVTAATMEVSSHALAQHRVDGLRFAGALFTNLSQDHLDYHPTMRDY
FEAKARLFEPERTAASVIGIEPGAGTWGLELAARVPGSVTYAPDPPADWWADDLTVGARG
SSFTARGPRGLAVPMEVRLPGRFNVANALGALALLVAAGIEPRAAAAGIGTLAGVPGRME
PIEAGQPYLALVDFAHTPDAVETVLTSVRGLVDGRVIVVLGCGGDRDRAKRPLMGAAAAR
LADLAFLTNDNPRSEDPAEILAQMTAGIDRVATSAAKVTVIPDRAEAIAAAVAEAGPGDV
VVVAGKGHERGQEQNGVVTPFDDRAVLAQAIADAGRPTGTGR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccaccggcactgcgcccggcccaccggccggcccgcacgctcaccgagctgcgc
gctctgctcgctgacctcggaagtgtccagcgcgccgccgcggccgacgtggcggcgccc
gaggtcgttttgcacggcgtcacgcacgactcccgcgccgtgcagcccggcgacctctac
gcggcactgcccggttcgcacgcccacggcgccgacttcgccgccgccgcggccgcgagc
ggcgccgccgccgtgctgaccgaccccgcgggcgccgcggcgctggccggctcggtcgac
ctgccggtggtcacgaccgccgacccgcgcagcgacgtcgcccaggtcgcggactggctg
tacggccagccgtcgcgcagcctcacgctgctcggcgtcaccgggaccaacggcaagacg
acctcggcgttcctggtcgacgccggcctgcgcgccgccggccaccgcaccggcctgctg
ggcaccgtcgagacccggatcgccgacgagcgcgtcgactcggtgcggaccaccccggag
tcgagtgacctgcaggcgctgttcgccgtgatggtggagcgcggcgtcaccgcggccacg
atggaggtctccagccacgcgctggcccagcaccgcgtcgacggcctgcggttcgccggc
gcgctgttcaccaacctcagccaggaccacctggactaccacccgacgatgcgggactac
ttcgaggccaaggcccgcctgttcgagcccgagcggaccgccgcgtcggtgatcgggatc
gagccgggcgccggcacctggggcctggagctggcggcccgcgttccgggatcggtcacc
tacgccccggacccgcccgccgactggtgggccgacgacctgaccgtcggcgcgcggggc
agctcgttcaccgcccgcggcccgcgcggtctcgccgtgccgatggaggtccgcctgccc
gggcggttcaacgtcgccaacgccctcggagcgctcgccctgctggtggccgccggcatc
gagccgcgggccgccgcggccggcatcggcacgctggccggcgtccccgggcgcatggag
ccgatcgaggccggccagccctatctggccctggtcgacttcgcgcacaccccggacgcc
gtcgagaccgtgctgacgtccgtgcgcgggctcgtcgacggccgggtgatcgtcgtcctc
ggctgcggcggcgaccgggaccgggccaaacgccccctgatgggtgccgccgcggcgcgg
ctggccgacctggccttcctgaccaacgacaacccgcgctccgaggacccggcggagatc
ctcgcccagatgaccgcgggcatcgaccgggtggccacctcggcggccaaggtgaccgtc
atcccggaccgggccgaggcgatcgccgcggccgtcgccgaggccggtccgggtgacgtc
gtcgtcgtcgcgggcaagggccacgaacgcggccaggagcagaacggcgtcgtcaccccg
ttcgacgaccgggccgtcctcgcccaggcgatcgccgacgccgggcggccgacgggcacg
ggccgatga

DBGET integrated database retrieval system