KEGG   Frankia sp. EuI1c: FraEuI1c_2723Help
Entry
FraEuI1c_2723     CDS       T01354                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_2723
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_2723
   00020 Citrate cycle (TCA cycle)
    FraEuI1c_2723
   00620 Pyruvate metabolism
    FraEuI1c_2723
Enzymes [BR:fri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FraEuI1c_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3313077..3314504
Genome map
AA seq 475 aa AA seqDB search
MTGRDFLLPDLGEGLAEAEIVQWLVRPGDPVALNQPLVEVETAKAAVEIPSPYAGVVAAL
HCAEGELVPVGTALLTVAAESVADAATGAEEAPPAPVVGRAPVEPAPGEVPRRRPRRAAH
TGLVAAAAAAPVQTAGPVLGAERRAPVARVALAPQRPAAPLVPAPNGLPRAKVLAAPPVR
KLARDLGVDLGTVHPTGPNGTIARADVTAAATPVPDPGPPRPAPSGVRPGERLPVRGVAR
QMALAMEHSAFQVPQATVQRTVDVTGLLDLLARWRADPPAGQVTAGQAPGGDRPVRITSL
AFISRAVVAAVARHPLANARWLTAADGSNEIEVYPAVNLGVAVASERGLVVPVIPAADRL
GLTALAGELASLVEAARAGRTPPARMRGSTITVSNVGVFGVDSAAGLVREGEAALVVLGA
IRDAAAVWQGEVQVRRVMTVSVSFDHRILHGEAASRFLGEIAAVLADPVSLLLHG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacggggcgggacttcctgctgcccgacctgggggagggcctcgcggaggccgagatc
gtccagtggctggtacgccccggcgacccggtggcgctcaaccagccgctcgtggaggtc
gagaccgcgaaggcggccgtcgagatcccgtcgccctacgccggcgtggtggcggccctg
cactgcgcggaaggtgagctcgtccccgtcgggacggccctgctgaccgtcgccgccgag
tcggtcgccgacgcggcgaccggggccgaggaggcgccgccggccccggtcgtcggccgg
gccccggtcgagccggcgcccggcgaggtgccgcgccgccggccccgtcgggccgcccac
acggggctcgtggccgccgcggcggcagccccggtccagaccgctggcccggtcctcggg
gcggagcgccgcgcgccggtcgcccgggtcgcgctcgctccccagcgccctgcggccccg
ctggttccggcgccgaacggtctgccgagggccaaggtgctggccgccccgccggtgcgc
aagctcgcccgcgacctcggcgtcgacctgggtacggtccacccgaccgggccgaacggc
accatcgcccgggccgacgtcacggcggccgccacaccggtcccggaccccgggccgccg
cgcccggcgccgtcgggcgtccggccgggcgagcgcctcccggtgcgcggcgtcgcgcgc
cagatggcgctggcgatggagcacagcgcgttccaggtgccacaggccacggtccagcgg
accgtcgacgtcaccggcctgctggacctgctcgcccgctggcgggcggacccgccggcc
ggccaggtcacagccggccaggcacccggcggcgaccggccggtcaggatcacgtcgctg
gccttcatcagccgcgccgtggtcgccgcggtcgcgcgccacccgctggcgaacgcccgc
tggctgacggccgccgacggctccaacgagatcgaggtgtacccggcggtcaacctgggc
gtggcggtggccagcgagcgcgggctcgtcgtcccggtgatccccgccgccgaccggctc
gggctgaccgccctggccggcgagctggcgagcctggtcgaggccgcgcgcgccgggcgc
accccaccggcgcggatgcgcggctcgacgatcaccgtgtccaacgtcggcgtcttcggg
gtggactcggccgccgggctggtccgcgagggcgaggcggccctggtcgtgctcggcgcg
atccgggacgcggccgccgtctggcagggagaggtccaggtccgccgggtgatgacggtc
tccgtgtccttcgaccaccggatcctgcacggcgaggccgcgtcgaggttcctgggcgag
atcgccgccgtgctcgccgacccggtcagcctgctgctgcacggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system