KEGG   Frankia sp. EuI1c: FraEuI1c_3322Help
Entry
FraEuI1c_3322     CDS       T01354                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fri  Frankia sp. EuI1c
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    FraEuI1c_3322
Enzymes [BR:fri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     FraEuI1c_3322
Transfer RNA biogenesis [BR:fri03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    FraEuI1c_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4070678..4071391
Genome map
AA seq 237 aa AA seqDB search
MDDHTLAAWLAVHAGARLLDIRSQGGAEGDRQSNELLLRLLAEARPDDAVLSEESVDDLA
RLDRERVWIIDPLDGTREYGEPPRTDWAVHVALAIRGRPAVGAVALPAAGLVLRTGAPPV
LPPARQGPIRLTVSRSRPPACVDHLRGHLDAELVPMGSAGAKAMAVVRGEADVYAHSGGQ
YEWDSCAPVAVAAAAGLHVSRLDGSPLLYNRPNPYLPDVLICHPALAGRVLGVLRRF
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccacacgctggcggcctggctcgccgtccacgccggcgcgcgtctgctcgac
atccgctcgcagggtggcgccgaaggcgaccggcagtcgaacgagctgctgcttcgcctg
ctggccgaggcgcgccccgacgacgccgtcctgtccgaggagagcgtcgacgacctcgcg
cgcctcgaccgggagcgcgtctggatcatcgatccactcgacggcacccgcgagtacggc
gaaccgccccggacggactgggcggtccacgtcgcgctggcgatccggggacggcccgcg
gtgggcgccgtagcgctgcccgccgcgggcctcgtcctgcgcacgggcgcacctccggtg
ctcccgcccgccaggcagggcccgattcgtctcacggtgtcgcgcagccggccgccggcc
tgtgtcgaccacctccgcgggcacctggacgccgagctggtccccatgggctcggccggc
gccaaggcgatggccgtcgttcggggtgaggccgacgtctacgcccactccggcggccag
tacgagtgggactcctgcgcgcccgtggcggtcgccgccgcggccggcctgcacgtctcg
cggctcgacgggagcccgttgctctacaaccggccgaatccctaccttcccgacgtactc
atctgtcacccggcgctcgcgggccgggtcctcggcgtgctccggcggttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system