KEGG   Frankia sp. EuI1c: FraEuI1c_3767Help
Entry
FraEuI1c_3767     CDS       T01354                                 

Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fri  Frankia sp. EuI1c
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fri00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FraEuI1c_3767
Enzymes [BR:fri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FraEuI1c_3767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4607163..4609349
Genome map
AA seq 728 aa AA seqDB search
MPEASSPVPDPLFAAFCAAGLWPGLGRTSAERLPAAGIRSPADVDLARLSAVEGMTGPRA
RRLLDSFRASTGRYEVAGLLADASLPVRLARGVSDELGASAADELRADPWALLAGGEADL
THADRLARSMGLGRDDPRRGPGVLVHLLTQAASRAGDTAGPVEALLTGAGREGVPDPAAA
LESAVEDGRLLPVGDRVGLERYAMAEQAVADGVERLLATAEPLRPGEPRRRRAKPPGVAA
QAGTDAAADDDESHQAAELDFGLGDDSADEADHESDEELAGGAQGADGGPAALADPSPAP
GGDDGVDEAVAGLDEVQLAAARLALESGVSVLTGGPGTGKSRTVAAVVRLAQAAGAEVAL
AAPTGRAAKRLEELCDTPASTLHRLLGAQGKGGGFARGEHYPLDAELVVVDEASMVDAEL
AAALIEALADGTHLLVVGDPAQLPSIGPGQLLADLIESGVVPVTELSRLYRQSAGGAIAQ
LATAVRGGELPPPAGGEDREVVVVAARSAAEAAHRVVQLVTDSIPRVLGIVPADVQVVTP
VHAGPAGTVALNAALKDRLNPGPGKVSGFDVGDRVVATANHLDVGFANGEIGVVTKLADR
GGLLVTFPGGTLEVPATALGDLRHGWAVTVHRAQGSEWPAVIAVFPPEAGRMLNRPLVYT
AITRARGHLSVVCVNGPALRQAVRSAGGRRRVTLLAPLLAGAELGEPDGDDDERDAAGAP
LRETEPVG
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggcgtcctcacctgtccctgacccgctgttcgccgcgttctgcgcggcgggg
ctgtggccggggctcgggcggaccagcgccgagcggctgcccgctgcgggaatccgctcc
cccgccgacgtcgacctggccaggctgtcggccgtcgaggggatgacggggccgcgggcc
cgccggctgctggattcgttccgcgcgtcgacgggccgttacgaggtcgccggcctgctc
gccgacgccagcctgccggtgcggctcgcccggggggtcagcgacgagctcggcgcctcg
gcggccgacgagctgcgcgccgacccgtgggcgctgctcgccggcggcgaggcggacctc
acccacgccgaccggctggcccgctcgatgggcctcggccgcgacgacccgcggcgcggg
ccgggggtgctcgtccacctgctcacccaggcggcgtcgcgcgccggtgacacggccggg
ccggtcgaggccctgctgacgggcgcgggccgcgagggcgtgcccgacccggcggcggcg
ctggagagcgcggtcgaggacgggcggctgctgcccgtcggcgaccgggtcgggctggag
cgctacgcgatggccgagcaggcggtcgccgacggcgtggagcggctgctggccacggcc
gagccgctgcgccccggcgagccacggcgccgccgggcgaagcctccgggcgtggccgcc
caggccggcaccgacgcggcggccgacgacgacgagagccaccaggccgccgagctcgat
ttcgggctgggcgacgactccgcggacgaggccgaccacgagagcgacgaggagctggcc
ggcggcgcgcagggcgcggatggcggcccggcggcgctggccgacccgtcacccgcgcca
ggcggtgacgacggggtggacgaggccgtcgcgggcctcgacgaggtgcagctggcggcg
gcgcggctcgcgctggagtccggcgtcagcgtgctcaccggcggaccgggcaccgggaag
agccggaccgtcgccgccgtcgtccggctcgcccaggcggccggcgccgaggtcgcgctg
gccgcgccgaccggccgggccgccaagcgcctcgaggagctgtgcgacaccccggccagc
acgctgcaccggctgctgggcgcccagggcaagggcggcgggttcgcccgcggcgagcac
tacccgctcgacgccgagctggtcgtcgtcgacgaggcgtcgatggtcgacgcggagctc
gccgccgcgctgatcgaggcgctcgccgacggcacccacctgctcgtcgtcggcgacccg
gcgcagctgccgagcatcggccccggccagctgctcgccgacctgatcgagtccggggtc
gtgccggtcaccgagttgagccggctctaccggcagtcggccggcggggcgatcgcgcag
ctcgcgacggcggtgcgcggcggcgagctgccaccgccggccggcggggaggaccgggag
gtggtcgtcgtcgccgcgcgctcggccgccgaggccgcgcaccgggtcgtgcagctggtc
accgactcgatcccgcgggtgctggggatcgtgccggccgacgtgcaggtcgtcaccccg
gtgcacgcgggcccggccggcacggtcgcgctgaacgccgccctgaaggaccggctgaac
ccgggccccggcaaggtcagcggcttcgacgtcggcgaccgggtcgtggcgaccgccaac
cacctcgacgtcgggttcgccaacggcgagatcggcgtcgtcacgaagctcgcggaccgg
ggcggtttgctcgtgacgttcccgggagggacgctggaggtgccggcgaccgcgctcggc
gacctgcgccacggctgggccgtcacggtgcaccgggcgcagggcagcgagtggccggcg
gtcatcgccgttttcccaccggaggccggccggatgctcaaccgcccgttggtctacacc
gcgatcactcgcgcccgcgggcacctgtcggtcgtctgcgtgaacggccccgcgctgcgc
caggcggtgcgctcggcgggcgggcgacggcgggtgacgttgctcgcgccgctgctggcc
ggcgccgagctgggcgagcccgacggcgacgacgacgagcgggacgcggcgggggcgccc
ctgcgcgagaccgagccggtcgggtga

DBGET integrated database retrieval system