KEGG   Frankia sp. EuI1c: FraEuI1c_3833Help
Entry
FraEuI1c_3833     CDS       T01354                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fri  Frankia sp. EuI1c
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FraEuI1c_3833
Enzymes [BR:fri01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     FraEuI1c_3833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4689087..4690067
Genome map
AA seq 326 aa AA seqDB search
MSPDPIGPPEATQVPRYAGPATFARLPRIDQVTRADVAVLGVPFDGGVSYRPGARFGPGH
VRESSRLLRQYNPAQDVTPFATQQVVDAGDVTCNPFDIPEALDAVERQARELLDGGARLL
TIGGDHTVALPLLRAVTARHGPVAVVHFDAHLDTWDTYFGAAYTHGTPFRRAAEEGLIDP
EASMHLGIRGPVYARSDFDDDTRLGFSVVTAPFVELEGVAAAVERLRARVGDRPVYVSVD
VDVLDPAFAPGTGTPEAGGLTTRELLVMLRAFADLNLVSADVVEVAPAYDHAQITGIAAA
HLGYELICAMTPRPPAPLDGARPDEA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccgacccgatcggtccgcccgaggccacccaggtgccgcgctacgccggacca
gccacgttcgcccggctgccccggatcgaccaggtcacccgcgcggacgtcgccgtcctc
ggcgtgccgttcgacggcggggtcagctaccggcccggcgcgcggttcggccccggccac
gtccgcgagagctcccggctgctgcgccagtacaacccggcgcaggacgtgacgccgttc
gccacgcagcaggtcgtcgacgccggcgacgtcacctgcaacccgttcgacatcccggag
gccctcgacgcggtcgagcgccaggcccgcgagctgctcgacgggggcgcccggctgctg
acgatcggcggcgaccacacggtcgcgctgccgctgctgcgggcggtcacggcccggcac
ggcccggtcgccgtggtgcacttcgacgcgcacctggacacctgggacacctacttcggc
gccgcctacacccacggcaccccgttccggcgggccgccgaggaggggctgatcgacccg
gaggccagcatgcacctgggcatccgcggcccggtgtacgcgcggtcggacttcgacgac
gacacccggctgggcttctccgtggtgaccgcgccgttcgtcgagctggagggcgtggcc
gccgcggtcgagcggctgcgggcccgggtcggcgaccggccggtgtacgtctcggtcgac
gtcgacgtgctcgacccggcgttcgcccccggcaccggcaccccggaggcgggtgggctg
accacccgggagctgctggtcatgctgcgggcgttcgccgacctgaacctggtctccgcc
gacgtggtcgaggtcgccccggcctacgaccacgcgcagatcaccggcatcgccgcggcc
cacctcggctacgagctgatctgcgccatgacgccacgcccgccggccccactcgacggg
gcccgacctgacgaggcctga

DBGET integrated database retrieval system