KEGG   Frankia sp. EuI1c: FraEuI1c_3833Help
Entry
FraEuI1c_3833     CDS       T01354                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00330  Arginine and proline metabolism
fri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FraEuI1c_3833
Enzymes [BR:fri01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     FraEuI1c_3833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489 ThiC_Rad_SAM
Motif
Other DBs
NCBI-ProteinID: ADP81840
UniProt: E3J461
Position
4689087..4690067
Genome map
AA seq 326 aa AA seqDB search
MSPDPIGPPEATQVPRYAGPATFARLPRIDQVTRADVAVLGVPFDGGVSYRPGARFGPGH
VRESSRLLRQYNPAQDVTPFATQQVVDAGDVTCNPFDIPEALDAVERQARELLDGGARLL
TIGGDHTVALPLLRAVTARHGPVAVVHFDAHLDTWDTYFGAAYTHGTPFRRAAEEGLIDP
EASMHLGIRGPVYARSDFDDDTRLGFSVVTAPFVELEGVAAAVERLRARVGDRPVYVSVD
VDVLDPAFAPGTGTPEAGGLTTRELLVMLRAFADLNLVSADVVEVAPAYDHAQITGIAAA
HLGYELICAMTPRPPAPLDGARPDEA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccgacccgatcggtccgcccgaggccacccaggtgccgcgctacgccggacca
gccacgttcgcccggctgccccggatcgaccaggtcacccgcgcggacgtcgccgtcctc
ggcgtgccgttcgacggcggggtcagctaccggcccggcgcgcggttcggccccggccac
gtccgcgagagctcccggctgctgcgccagtacaacccggcgcaggacgtgacgccgttc
gccacgcagcaggtcgtcgacgccggcgacgtcacctgcaacccgttcgacatcccggag
gccctcgacgcggtcgagcgccaggcccgcgagctgctcgacgggggcgcccggctgctg
acgatcggcggcgaccacacggtcgcgctgccgctgctgcgggcggtcacggcccggcac
ggcccggtcgccgtggtgcacttcgacgcgcacctggacacctgggacacctacttcggc
gccgcctacacccacggcaccccgttccggcgggccgccgaggaggggctgatcgacccg
gaggccagcatgcacctgggcatccgcggcccggtgtacgcgcggtcggacttcgacgac
gacacccggctgggcttctccgtggtgaccgcgccgttcgtcgagctggagggcgtggcc
gccgcggtcgagcggctgcgggcccgggtcggcgaccggccggtgtacgtctcggtcgac
gtcgacgtgctcgacccggcgttcgcccccggcaccggcaccccggaggcgggtgggctg
accacccgggagctgctggtcatgctgcgggcgttcgccgacctgaacctggtctccgcc
gacgtggtcgaggtcgccccggcctacgaccacgcgcagatcaccggcatcgccgcggcc
cacctcggctacgagctgatctgcgccatgacgccacgcccgccggccccactcgacggg
gcccgacctgacgaggcctga

DBGET integrated database retrieval system