KEGG   Frankia sp. EuI1c: FraEuI1c_4107Help
Entry
FraEuI1c_4107     CDS       T01354                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
fri  Frankia sp. EuI1c
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    FraEuI1c_4107
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FraEuI1c_4107
   00650 Butanoate metabolism
    FraEuI1c_4107
  Amino acid metabolism
   00360 Phenylalanine metabolism
    FraEuI1c_4107
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FraEuI1c_4107
   00622 Xylene degradation
    FraEuI1c_4107
   00621 Dioxin degradation
    FraEuI1c_4107
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     FraEuI1c_4107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5000347..5001291
Genome map
AA seq 314 aa AA seqDB search
MSTVKVAVIGSGNIGTDLMIKVLRLSERLEITAMVGIDPDSDGLARARRLKVSTTHEGIH
GLARMDEFADLEIVFDATSAGAHRRNNEVLQAHGKHVVDLTPAAIGPYVVPSVNLDAHLD
APNVNMVTCGGQATIPIVAAVNATSPVHYGEIVASIASRSAGPGTRANIDEFTETTSAAI
EKVGGASRGKAIIVLNPAEPPLIMRDTVYCVVGDCDDAAVTRSVEDMVARVQAYVPGYGL
KQKVQFERVADDDPVRTLAPAGTGTVTKVSVFLEVEGAAHYLPAYAGNLDIMTSAALRTA
ERIAERATTGIRAR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggtcaaggtggccgtcatcgggtcgggcaacatcgggaccgacctgatgatc
aaagttctccggctgtcggaacgcctggagatcaccgcgatggtcggcatcgacccggac
tccgacggcctcgcccgagcccgccgcctgaaggtctcgacgacgcacgagggcatccac
ggcctggcgcggatggacgagttcgccgacctggagatcgtcttcgatgccacctcggcg
ggtgcgcaccggcgcaacaacgaggtcctgcaggcccacggcaagcacgtcgtcgacctc
accccggcggcgatcggcccctatgtcgtcccgtcggtgaacctcgacgcccacctggac
gcgccgaacgtcaacatggtgacctgcggcggccaggcgacgatcccgatcgtcgcggcg
gtcaacgccaccagcccggtccactatggcgagatcgtcgcctcgatcgcgtcgaggtcg
gccggacccggcacccgagccaacatcgacgagttcaccgagacgacgtcggcggcgatc
gagaaggtcggcggtgcgtcccgcggtaaggcgatcatcgtcctgaacccggccgagcct
ccactgatcatgcgcgacaccgtctactgcgtcgtcggtgactgtgacgacgccgccgtc
accaggtccgtcgaggacatggtcgcccgggtgcaggcctacgttcccggctacgggctc
aagcagaaggtccagttcgaacgggtcgctgacgacgaccccgtccggacgctcgcgccg
gccggcaccggcacggtgaccaaggtgtcggtgttcctcgaggtcgagggcgccgcccac
tacctgccggcttacgccggcaacctggacatcatgacctcggccgcgctgcgcaccgcg
gaacggatcgctgagcgggccacgacagggatacgcgcccgatga

DBGET integrated database retrieval system