KEGG   Frankia sp. EuI1c: FraEuI1c_4515Help
Entry
FraEuI1c_4515     CDS       T01354                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fri  Frankia sp. EuI1c
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FraEuI1c_4515
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FraEuI1c_4515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5521576..5522772
Genome map
AA seq 398 aa AA seqDB search
MTPAATDAGPTAETSPAEPLEPLAGYTIGITAARRRKELGAALERRGAKVVYAPAIQIVP
LADDSELLQATERCLAAPLDVVVATTGIGFRGWMDAAETWGLAEKLTEAVDAATVLARGP
KARGAIRAGGLRETWSPESESSSEVLDYLMSGDDLSGKRIAVQLHGEPLRDLVDTLRLAG
ADVIEVPVYRWVPPDDPAPLYRLLDTVATGGVDAVAFTSAPAAVSFLQTADQRDCGPAVR
AALRGPVLAACVGPVTAGPLVREDIPVVQPGRSRLGALAREIVEQVPARQGQLVPAAGHL
LDVRGHAVAVDGRLVPLSSASMALLRQLIARPGQVVSRRDLLGLTPGDGGDEHAVEVAVG
RLRAALGDPRIVLTVVKRGYRLAYEPERASSRDGHWRY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccggccgccaccgacgccgggccgactgcggagacttcgccggcagaacccctg
gaaccactggccggctacacgatcggcatcaccgccgcccgccgccgcaaggaactcggg
gccgcgctcgaacggcgcggcgccaaggtcgtctacgccccggccatccagatcgtgccc
ctggccgacgacagcgagctgctccaggccaccgagcgctgcctggccgcgccgctggac
gtcgtcgtcgcgacgaccgggatcgggttccgcggctggatggacgccgccgagacctgg
ggcctggccgagaagctcaccgaggccgtcgacgcggccaccgtcctcgcccgcggcccg
aaggcccgcggcgcgatccgggccggcggcctgcgcgagacctggtcgccggagtcggag
tcatccagcgaggtcctcgactacctgatgtccggcgacgacctgagcgggaagcggatc
gccgtccagctgcacggcgagccgctgcgggacctggtcgacacactgcggctggccggc
gccgacgtcatcgaggtccccgtctaccggtgggtgccgccggacgacccggcgccgctc
taccggctcctggacaccgtggcgaccggcggggtcgacgcggtcgccttcaccagcgct
ccggcggcggtcagcttcctgcagaccgccgaccagcgggactgcggtccggccgtgcgg
gccgcgctgcgcgggccggtgttggcggcctgcgtgggcccggtgacggccgggccgctg
gtgcgtgaggacattcccgtcgtacagccggggcgcagccggctcggggcgctggcgcgg
gagatcgtagagcaggttccggcccggcaggggcagctggtgccggcggccgggcatctg
ctcgacgtgcgtgggcacgctgtggcggtcgatgggcggctggtgccgctcagcagcgcg
agcatggcgctgttgcgccagctgatcgccaggcctggtcaggtcgtgtcgcgtcgtgat
ctgttggggctcactccgggggatggcggggacgagcatgcggtggaggtcgcggtcggg
cggctgcgggcggcgctcggggacccgcggatcgtgctgacggtggtcaagcgcggttac
cggctcgcctacgagcccgaacgagcgagcagccgcgacgggcactggcggtactga

DBGET integrated database retrieval system