KEGG   Frankia sp. EuI1c: FraEuI1c_4515Help
Entry
FraEuI1c_4515     CDS       T01354                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00860  Porphyrin and chlorophyll metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FraEuI1c_4515
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FraEuI1c_4515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADP82508
UniProt: E3IVK2
Position
5521576..5522772
Genome map
AA seq 398 aa AA seqDB search
MTPAATDAGPTAETSPAEPLEPLAGYTIGITAARRRKELGAALERRGAKVVYAPAIQIVP
LADDSELLQATERCLAAPLDVVVATTGIGFRGWMDAAETWGLAEKLTEAVDAATVLARGP
KARGAIRAGGLRETWSPESESSSEVLDYLMSGDDLSGKRIAVQLHGEPLRDLVDTLRLAG
ADVIEVPVYRWVPPDDPAPLYRLLDTVATGGVDAVAFTSAPAAVSFLQTADQRDCGPAVR
AALRGPVLAACVGPVTAGPLVREDIPVVQPGRSRLGALAREIVEQVPARQGQLVPAAGHL
LDVRGHAVAVDGRLVPLSSASMALLRQLIARPGQVVSRRDLLGLTPGDGGDEHAVEVAVG
RLRAALGDPRIVLTVVKRGYRLAYEPERASSRDGHWRY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccggccgccaccgacgccgggccgactgcggagacttcgccggcagaacccctg
gaaccactggccggctacacgatcggcatcaccgccgcccgccgccgcaaggaactcggg
gccgcgctcgaacggcgcggcgccaaggtcgtctacgccccggccatccagatcgtgccc
ctggccgacgacagcgagctgctccaggccaccgagcgctgcctggccgcgccgctggac
gtcgtcgtcgcgacgaccgggatcgggttccgcggctggatggacgccgccgagacctgg
ggcctggccgagaagctcaccgaggccgtcgacgcggccaccgtcctcgcccgcggcccg
aaggcccgcggcgcgatccgggccggcggcctgcgcgagacctggtcgccggagtcggag
tcatccagcgaggtcctcgactacctgatgtccggcgacgacctgagcgggaagcggatc
gccgtccagctgcacggcgagccgctgcgggacctggtcgacacactgcggctggccggc
gccgacgtcatcgaggtccccgtctaccggtgggtgccgccggacgacccggcgccgctc
taccggctcctggacaccgtggcgaccggcggggtcgacgcggtcgccttcaccagcgct
ccggcggcggtcagcttcctgcagaccgccgaccagcgggactgcggtccggccgtgcgg
gccgcgctgcgcgggccggtgttggcggcctgcgtgggcccggtgacggccgggccgctg
gtgcgtgaggacattcccgtcgtacagccggggcgcagccggctcggggcgctggcgcgg
gagatcgtagagcaggttccggcccggcaggggcagctggtgccggcggccgggcatctg
ctcgacgtgcgtgggcacgctgtggcggtcgatgggcggctggtgccgctcagcagcgcg
agcatggcgctgttgcgccagctgatcgccaggcctggtcaggtcgtgtcgcgtcgtgat
ctgttggggctcactccgggggatggcggggacgagcatgcggtggaggtcgcggtcggg
cggctgcgggcggcgctcggggacccgcggatcgtgctgacggtggtcaagcgcggttac
cggctcgcctacgagcccgaacgagcgagcagccgcgacgggcactggcggtactga

DBGET integrated database retrieval system