KEGG   Frankia sp. EuI1c: FraEuI1c_4705Help
Entry
FraEuI1c_4705     CDS       T01354                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_4705
   01230 Biosynthesis of amino acids
    FraEuI1c_4705
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_4705
   00030 Pentose phosphate pathway
    FraEuI1c_4705
   00051 Fructose and mannose metabolism
    FraEuI1c_4705
   00052 Galactose metabolism
    FraEuI1c_4705
  Energy metabolism
   00680 Methane metabolism
    FraEuI1c_4705
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FraEuI1c_4705
Enzymes [BR:fri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FraEuI1c_4705
Protein phosphatases and associated proteins [BR:fri01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FraEuI1c_4705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5760199..5761557
Genome map
AA seq 452 aa AA seqDB search
MATLGEPLIVDHSTLAVRSLGPSRVTSPLLPLLGERPTTEHYIDEADKVLLDDTLAMVSS
RNVPLAELPSFEAAGPRRKIYFDPAKTRVGIVTCGGLCPGLNNVIRGLVTELTTHYGVTR
IFGFRNGYQGFIARYGHDVVDLTAERVATIGEDGGTILGTSRGQQDPEEIVDCLSRMNIS
ILFVIGGDGTLRGAGEIARVATERGEKIAVVGIPKTIDNDIPFIDQSFGFQTAFAKASES
IAAAHAEATSAPGGLGLVRLMGRHSGFIACYASLAKSDADVVLIPEVPFTLDGENGLLRY
LRRRIEETGHAVVVAAEGAGQELFDAQSNGLGTGTDASGNRRLSDVGQFLSGRIVDYFTS
AGVEINLKYIDPSYVIRSVPANPYDSVYCIRLAHAAVHAAMAGRTEMVVGRWRRRFIHIP
IPLAISHRNQVDPSGDLWMSVLEATGQPPRFQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtggctacgctgggcgaaccactgatcgtcgatcattcgacgctggcggtccgtagcctc
gggcccagtcgggtgacctcgcccctgctgcccctgttgggcgagcggccgaccaccgag
cactacatcgacgaggccgacaaggtcctgctcgacgacacgctggcgatggtctcgtcg
cgcaacgtcccgctggccgagctgcccagcttcgaggcggccggcccgcgccggaagatc
tacttcgacccggcgaagaccagggtcggcatcgtcacctgcggcggcctgtgccccggg
ctgaacaacgtcatccggggcctggtgaccgagctcaccacgcactacggcgtgacccgc
atcttcggcttccgcaacggctatcagggattcatcgcgcgctacggccacgacgtcgtc
gacctgacggcggagcgggtcgcgacgatcggcgaggacggcggcacgattctcggcacg
tcccggggccagcaggacccggaggagatcgtcgactgcctgtcccgcatgaacatcagc
attcttttcgtcatcggcggcgacgggacgctgcgcggcgccggcgagatcgcccgggtc
gccaccgagcggggcgagaagatcgccgtcgtcgggataccgaagacgatcgacaacgac
attccgttcatcgaccagagcttcggcttccagaccgcgttcgcgaaggcgagcgagtcg
atcgccgccgcgcacgcggaggcgacgtccgcgcccggcgggctcgggctcgtccggctg
atgggacggcattccggcttcatcgcctgctatgcctcgctggccaagtcagacgccgac
gtggtgctcattcccgaggtgcccttcacgctcgacggcgagaacgggctgctgcgctac
ctgcgccgccggatcgaggagaccggccacgcggtggtggtcgccgccgaaggcgccggc
caggagctcttcgacgcgcagagcaacggcctcgggaccggcaccgacgcctcaggcaac
cggcggctgtcggacgtgggccagttcctcagcggccggatcgtcgactacttcaccagc
gccggcgtcgagatcaacctgaagtacatcgacccgagctacgtcatccgcagcgtgccg
gccaacccgtacgacagcgtctactgcatccggctggcgcacgccgccgtgcacgccgcg
atggccggtcgcaccgagatggtcgtgggccgctggcggcgccggttcatccacatcccg
atcccgctggcgatcagccaccgcaaccaggtcgacccgtcgggtgacctgtggatgtcg
gtgctggaagccaccggccagccgccccgctttcagtag

DBGET integrated database retrieval system