KEGG   Frankia sp. EuI1c: FraEuI1c_4781Help
Entry
FraEuI1c_4781     CDS       T01354                                 

Definition
asparagine synthase family amidotransferase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fri  Frankia sp. EuI1c
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FraEuI1c_4781
Enzymes [BR:fri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     FraEuI1c_4781
Peptidases [BR:fri01002]
 Cysteine Peptidases
  Family C44
   FraEuI1c_4781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5859864..5861645)
Genome map
AA seq 593 aa AA seqDB search
MCGLSGELRLDGQPADVAAVARMTAALERRGPDGVGLFSAGPVALGHRRLKIIDLSERGA
QPMTDPELGLTAVFNGCVYNYQELRDELTAAGYRFFSGSDTEVVLKAYHRWGVGFVDHFA
GMFAIAVHERDSGRLVLARDRLGIKPLYVSADAHRIRFASTLPALLAGGGVDTELDLVAL
HHYLSFHAIVPPPRTILRGVRKLPQATVRVIEPDGTSTDKVYWRPDFTRRAEHANWSALD
WRDAVAEKLRVAVRRRMVADVPVGVLLSGGLDSSMIVALLAQAGQTGLATFSVGFDAAGG
ETGDEFHYSDLVAEHFGTDHHQILVPTVDLAPAVDAAIDAMSEPMVSHDCVAFYLLSQEV
AKDVTVVQSGQGADEVFAGYSWYRPLAAVPRDQAVENYLRVFADRAHADLAAVVSPDHLI
EADASRHFVAEHFAYPGAETTVDAALRIDSTIMLVDDPVKRVDNMTMAAGLEARTPFLDH
ELVELAAACPPELKLASGGKGVLKDISRTLLPDEVIDRPKGYFPVPAIRHLSGPILDRVA
AALHAPAARGRGLYRPDWVTAALAAPNEERTNLGANALWQVGLLEMWLQAHGI
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggctgagcggggagctacggctggacggccagccggctgacgtcgcggcggtc
gccaggatgacggcggcgctggaacggcgcggcccggacggcgtcggcctgttctcggcc
ggcccggtggcgctcggccaccgccggctgaagatcatcgacctgtccgagcgcggcgcg
cagccgatgaccgaccccgagctcggcctcacggccgtgttcaacgggtgcgtctacaac
taccaggaactgcgcgacgagctgaccgccgccggctaccggttcttctccggctcggac
accgaggtcgtgctcaaggcctaccaccggtggggggtcggcttcgtcgaccacttcgcc
gggatgttcgcgatcgccgtccacgagcgcgacagcggccggctggtgctcgcccgagac
cgcctcggcatcaagccgctctacgtcagcgccgacgcccaccggatccggttcgcctcg
accctgcccgcgctgctcgccggcggcggggtggacaccgagctcgacctggtggcgctg
caccactacctgtcgttccacgcgatcgtcccgcccccgcgcacgatcctgcgcggggtg
cgcaagctgccccaggccacggtccgcgtgatcgagccggacgggaccagcaccgacaag
gtctactggcggccggacttcacccgccgcgccgagcacgccaactggtcggcgctcgac
tggcgtgacgccgtcgcggagaagctgcgcgtcgcggtccgccgccggatggtcgccgac
gtgccggtcggcgtgctgctgtccggcgggctggactccagcatgatcgtcgcgctgctc
gcccaggccgggcagacgggcctggcgacgttcagcgtgggcttcgacgcggccggcggg
gagacgggcgacgagttccactactccgacctggtcgccgagcacttcggcaccgaccat
catcagatcctcgtgccgaccgtggacctggcgcccgcggtggacgcggccatcgacgcg
atgagcgagccgatggtcagccacgactgcgtcgcgttctacctgctgtcccaggaggtc
gccaaggacgtgaccgtggtgcagtccgggcagggcgccgacgaggtgttcgccggctac
tcctggtaccggccgctcgccgccgtgccccgagaccaggccgtcgagaactacctgcgg
gtcttcgccgaccgggcccacgccgacctggccgcggtcgtctcgcccgaccacctgatc
gaggccgacgcgagccggcacttcgtcgccgagcacttcgcgtacccgggcgccgagacg
accgtcgacgcggcgctgcggatcgactccacgatcatgctggtcgacgacccggtgaag
cgggtcgacaacatgacgatggccgccgggctggaggcgcgcacgccgttcctcgaccac
gagctggtcgagctcgcggccgcctgcccgccggagctcaagctcgcctccggcggcaag
ggcgtcctgaaggacatcagccgcacgctgctgccggacgaggtgatcgaccgtccgaag
ggctacttcccggtgccggcgatccgccacctgtccggcccgatcctcgaccgggtggcc
gcggcgctgcacgccccggcggcccgcggccgaggcctctaccggcctgactgggtgacg
gcggcgctcgccgcgcccaacgaggagcgcacgaacctcggcgcgaacgcgctctggcag
gtcggcctgctggagatgtggctgcaggcccacggaatctga

DBGET integrated database retrieval system