KEGG   Frankia sp. EuI1c: FraEuI1c_4801Help
Entry
FraEuI1c_4801     CDS       T01354                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
fri  Frankia sp. EuI1c
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FraEuI1c_4801
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    FraEuI1c_4801
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     FraEuI1c_4801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5888790..5889662
Genome map
AA seq 290 aa AA seqDB search
MAIVLGPNQFGKAEVRLVHVDRSTPVHRITDLNVSTALRGDFAAAHLTGDNAHIHTTDAQ
KNTVYAFARDGVGEIEEFGLRLARHFTGAFGWITGSRIEIEQYGWDRIPVGGAGHDHAFS
RAGAERRTTVVTVDGDDAYIVSGLAGLVVLKSTGSEFWGYATDRYTTLAETTDRILATEV
TARWRLTGADHDYGKLFTSIRTILLETFASVHSLALQQTLYKMSEEVLTAHPEVAEIRMS
MPNKHHFLVDLEPYGLDNPNTVFYAADRPYGKIEGTVTRDDADPAGPAWL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgttctcgggccgaaccagttcgggaaggcggaggtgcggctggtccatgtg
gaccggtcgaccccggtgcacaggatcaccgacctcaacgtgtcgaccgcgctgcgtggc
gacttcgccgcggcgcatctgaccggtgacaacgcgcacatccacaccacggacgcgcag
aagaacaccgtctacgcgttcgcgcgggacggcgtcggcgagatcgaggagttcgggctg
cggctggcccggcatttcaccggagcgttcggttggattaccggcagccggatcgagatc
gaacagtacggctgggaccgcatcccggtcggcggcgccggacatgaccatgcattcagc
cgggccggcgccgaacggcgcaccacggtcgtcacggtggacggcgacgacgcatacatc
gtttccggcctcgccgggctggtcgtgctgaagtcgacaggttcggagttctggggctac
gcgaccgaccgctataccacgctcgccgagaccaccgaccggatcctcgccaccgaggtg
accgcgcgctggcgcctcaccggcgcggaccacgactacgggaagctgttcaccagcatt
cggacgatcctgctggagaccttcgcctcggtacacagcctcgcgttgcagcagacgctc
tacaagatgagtgaggaggtgctgacggcacatccggaggtggccgagatcaggatgtcg
atgccgaacaagcaccattttctggtcgacctggaaccgtacggtctcgacaacccgaac
accgtcttctacgcggcggaccgcccgtacgggaagatcgagggaacggtgaccagggac
gacgcagacccggccggcccggcgtggctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system