KEGG   Frankia sp. EuI1c: FraEuI1c_4801Help
Entry
FraEuI1c_4801     CDS       T01354                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
fri  Frankia sp. EuI1c
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fri00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5888790..5889662
Genome map
AA seq 290 aa AA seqDB search
MAIVLGPNQFGKAEVRLVHVDRSTPVHRITDLNVSTALRGDFAAAHLTGDNAHIHTTDAQ
KNTVYAFARDGVGEIEEFGLRLARHFTGAFGWITGSRIEIEQYGWDRIPVGGAGHDHAFS
RAGAERRTTVVTVDGDDAYIVSGLAGLVVLKSTGSEFWGYATDRYTTLAETTDRILATEV
TARWRLTGADHDYGKLFTSIRTILLETFASVHSLALQQTLYKMSEEVLTAHPEVAEIRMS
MPNKHHFLVDLEPYGLDNPNTVFYAADRPYGKIEGTVTRDDADPAGPAWL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgttctcgggccgaaccagttcgggaaggcggaggtgcggctggtccatgtg
gaccggtcgaccccggtgcacaggatcaccgacctcaacgtgtcgaccgcgctgcgtggc
gacttcgccgcggcgcatctgaccggtgacaacgcgcacatccacaccacggacgcgcag
aagaacaccgtctacgcgttcgcgcgggacggcgtcggcgagatcgaggagttcgggctg
cggctggcccggcatttcaccggagcgttcggttggattaccggcagccggatcgagatc
gaacagtacggctgggaccgcatcccggtcggcggcgccggacatgaccatgcattcagc
cgggccggcgccgaacggcgcaccacggtcgtcacggtggacggcgacgacgcatacatc
gtttccggcctcgccgggctggtcgtgctgaagtcgacaggttcggagttctggggctac
gcgaccgaccgctataccacgctcgccgagaccaccgaccggatcctcgccaccgaggtg
accgcgcgctggcgcctcaccggcgcggaccacgactacgggaagctgttcaccagcatt
cggacgatcctgctggagaccttcgcctcggtacacagcctcgcgttgcagcagacgctc
tacaagatgagtgaggaggtgctgacggcacatccggaggtggccgagatcaggatgtcg
atgccgaacaagcaccattttctggtcgacctggaaccgtacggtctcgacaacccgaac
accgtcttctacgcggcggaccgcccgtacgggaagatcgagggaacggtgaccagggac
gacgcagacccggccggcccggcgtggctctga

DBGET integrated database retrieval system