KEGG   Frankia sp. EuI1c: FraEuI1c_4856Help
Entry
FraEuI1c_4856     CDS       T01354                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FraEuI1c_4856
Enzymes [BR:fri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FraEuI1c_4856
Exosome [BR:fri04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FraEuI1c_4856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5956238..5957728
Genome map
AA seq 496 aa AA seqDB search
MVAVDQGTTGTTVCVLDQSAHVVGRAQTEVTVTYPRPGWVEQDPEQLWGGVVATVSAALR
AAGRAPADIAAVGITNQRETTVVWDRRTGRPVAPAIVWQDRRTSGACERLAAAGHGPEVA
ERTGLVLDPYFSGTKIAWLLADDPELARRAGRGELAFGTVDTWLIWRLTGGRTHVTDVTN
ASRTLLLDLADATWSAPMAELLGVPMELLAEVRPSSEVYAETDPASFLGVSVPVAAAVGD
QQAALFAQACFAQGQAKNTYGTGSFVLLNTGPTPPPPREDGALLRTAAFQLAGEPVHYAL
EGAVLATGSAVQWLRDGLGVVGSAAETAQLAGSLSGNDGVYFVPALAGLGAPHWDPRARG
TLVGLTRGTGRAHLARAVLESIAYRTRDIVEAMTAAGTPVTELRADGGAAANPWLMQFQA
DVLGIPVDVPDNLETTALGSGYLAGLATGVFPDRAALAGLRRTAARYEPALAPATRDSLY
ADWLRALDRSRDWAQD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggtggccgtcgaccagggaaccactggcacgaccgtatgcgtcctggaccagtccgcg
cacgtcgtgggccgggcgcagaccgaggtgaccgtcacctacccccggcccggctgggtc
gagcaggacccggagcagctgtggggcggggtcgtggccacggtgtccgccgcgctgagg
gccgccgggcgcgcgccggcggacatcgccgccgtcggcatcaccaaccagcgcgagacg
acggtcgtctgggaccggcgcacgggccggccggtcgcccctgcgatcgtctggcaggac
cggcgcacgtcaggcgcctgcgagcggctcgccgcggccggccacggccccgaggtcgcc
gagcgcaccgggctggtgctggacccgtacttctccggcacgaagatcgcctggctgctg
gcggacgaccccgagctggcccggcgcgccgggcggggcgagctggcgttcggcacggtc
gacacgtggctgatctggcggctcaccggcggccggacccacgtgaccgatgtcaccaac
gcctcccgcaccctgctgctcgacctggccgacgcgacctggtccgcgccgatggccgag
ctgctcggggtgccgatggagctgctggccgaggtccggcccagctccgaggtctacgcc
gagaccgacccggcctcgttccttggcgtctcggtgccggtcgcggccgcggtcggcgac
cagcaggccgcgctgttcgcgcaggcctgcttcgcgcagggccaggcgaagaacacctac
gggaccggctcgttcgtcctgctgaacaccggcccgacgccgccgccaccccgcgaggac
ggcgcgctgctgcgcaccgccgcgttccagctggccggcgagccggtccactacgcgctg
gagggggcggtcctcgccaccggctcggccgtgcagtggctgcgcgacgggctcggcgtg
gtcggctccgccgccgagacggcgcagctcgcggggtcgctgagcggcaacgacggcgtc
tacttcgtcccggcgctcgccgggctcggcgcgccgcactgggacccccgggcgcgcggg
accctggtcgggctgacgcgaggcaccggccgggcccatctggcccgcgccgtgctggag
tccatcgcctaccgcacccgggacatcgtcgaggcgatgaccgccgcaggcacgcccgtg
accgagctgcgcgcggacggcggagccgccgccaacccgtggctcatgcagttccaggcg
gacgtcctgggcattccggtggacgtgccggacaacctggagacgaccgcgctcggctcc
gggtatctcgcgggcctcgccaccggcgtcttccccgaccgggccgcgctcgccggcctg
cggcgcaccgccgcccgctacgagccggccctcgccccggctacccgcgacagcctctac
gccgactggctgcgcgccctggaccgctcccgcgactgggcccaggactga

DBGET integrated database retrieval system