KEGG   Frankia sp. EuI1c: FraEuI1c_4877Help
Entry
FraEuI1c_4877     CDS       T01354                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_4877
   01230 Biosynthesis of amino acids
    FraEuI1c_4877
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_4877
   00051 Fructose and mannose metabolism
    FraEuI1c_4877
   00562 Inositol phosphate metabolism
    FraEuI1c_4877
Enzymes [BR:fri01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FraEuI1c_4877
Exosome [BR:fri04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FraEuI1c_4877
  Exosomal proteins of bladder cancer cells
   FraEuI1c_4877
  Exosomal proteins of melanoma cells
   FraEuI1c_4877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5980678..5981520)
Genome map
AA seq 280 aa AA seqDB search
MTPLRQGPATGKQPAVARKSKGTGRQTLVAGNWKMNLNHLEAIALVQKIAYDLKPAELET
VETVIFPPFIDLRSVQTAIDGDKLAIGYGAQDLSPFDSGAHTGDVSGPMLAKLGCGYVIV
GHSERRTDHHEDDALVAAKVAAAYRSGLTPIVCVGEHEDVRVAGNHVEHCLAQLEGSLAG
LKPAQAKTVVIAYEPVWAIGTGRTASAQDAQDMCAALRERLAGLFDAELAAGIRVLYGGS
VKASSAGELFTMPDVDGGLVGGASLVAEEFTAIVRSGPPA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgactccgctgcgccagggcccggcgaccggcaaacagcccgccgtcgcccgcaagtcc
aagggcaccggccgccagacgctggtcgccggcaactggaagatgaacctcaaccacctt
gaggcgatcgccctcgtccagaagatcgcctatgacctgaagccggccgagctggagacc
gtcgagacggtcatcttcccgccgttcatcgacctgcgcagcgtgcagaccgcgatcgac
ggggacaagctcgccatcggctacggcgcccaggacctctcgccgttcgactccggcgcg
cacacgggcgacgtgtccgggccgatgctggccaagctcggctgcggctacgtgatcgtc
ggccactccgagcggcggaccgaccaccacgaggacgacgcgctggtcgcggccaaggtc
gccgccgcctaccgcagtggcctgacgccgatcgtctgcgtcggcgagcacgaggacgtc
cgcgtggccggcaaccacgtcgagcactgcctggcccagcttgagggctcgctggccggc
ctgaagccggcgcaggcgaagacggtcgtcatcgcctacgagccggtctgggcgatcggc
accggccggaccgcgtcggcccaggacgcccaggacatgtgcgcggcgctccgggagcgg
ctggccggcctgttcgacgcggagctcgcggccggcatccgggtgctctacggcggctcg
gtcaaggcgtcgagcgcgggcgagctgttcaccatgccggacgtcgacggcggcctggtc
ggcggcgcgagcctggtggcggaggagttcaccgcgatcgtgcgcagcggcccgccggcc
tga

DBGET integrated database retrieval system