KEGG   Frankia sp. EuI1c: FraEuI1c_4970Help
Entry
FraEuI1c_4970     CDS       T01354                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fri01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fri00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fri00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6120495..6121322)
Genome map
AA seq 275 aa AA seqDB search
MGQGTPGRVADVFAAARKEGRAVLVGYLPAGYPSVDGAIDALRAMVEAGVDIVELGLPYS
DPTIDGPVIQEAVDAALRGGVTTADVLRTVEAVAATGAPTLVMTYWNPIERHGVERFAAD
LAAAGGAGTITPDLPPEEAGPWLEAAGRHGLDSVFLVAPSSSDARLRRVTGIASGFVYAA
SLMGVTGVRESVGAAAEGLVNRVRGVTDLPVAVGLGVRDGAQAATVAGFADGVIVGTALV
GCLVDAERSGAGREAGIAAVRKLTADLAAGVRAGS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgggacagggcacaccggggcgggtcgcggatgttttcgcggcggcccgcaaggaaggc
cgcgcggtcctcgtcggctacctgccggcgggctacccgtcggtggacggcgcgatcgac
gcgttgcgcgcgatggtcgaggccggggtcgacatcgtcgagctcgggctgccgtactcg
gacccgacgatcgacgggccggtcatccaggaggccgtggacgcggcgctgcggggcggt
gtgaccaccgccgacgtgctgcgcaccgtcgaggccgtcgccgcgaccggcgcgccgacg
ctcgtgatgacctactggaacccgatcgagcggcacggtgtcgagcggttcgccgccgac
ctcgccgccgccgggggcgccggcacgatcacgccggacctgccgcccgaggaggccggc
ccgtggctggaggccgccggccggcacgggctcgactcggtgttcctggtcgcgcccagc
tcttcggacgcccggctgcgacgagtgaccggcatcgccagcggcttcgtctacgccgcg
tcgctgatgggcgtcaccggcgtccgggagtcggtcggcgccgcggccgagggcctggtc
aaccgggtgcgcggcgtcaccgacctgccggtggcggtcggtctgggggtccgggacggg
gcccaggcggcgaccgtggcgggcttcgccgacggagtgatcgtcggcaccgcgctggtc
ggctgcctggtcgacgcggaacgctccggcgccggccgcgaggctggcatcgccgcggtc
cgcaagctcaccgccgacctcgcggccggcgtccgcgccggttcctga

DBGET integrated database retrieval system