KEGG   Frankia sp. EuI1c: FraEuI1c_4970Help
Entry
FraEuI1c_4970     CDS       T01354                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00260  Glycine, serine and threonine metabolism
fri00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01130  Biosynthesis of antibiotics
fri01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FraEuI1c_4970
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FraEuI1c_4970
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FraEuI1c_4970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA KDGP_aldolase Radical_SAM His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADP82959
UniProt: E3J309
Position
complement(6120495..6121322)
Genome map
AA seq 275 aa AA seqDB search
MGQGTPGRVADVFAAARKEGRAVLVGYLPAGYPSVDGAIDALRAMVEAGVDIVELGLPYS
DPTIDGPVIQEAVDAALRGGVTTADVLRTVEAVAATGAPTLVMTYWNPIERHGVERFAAD
LAAAGGAGTITPDLPPEEAGPWLEAAGRHGLDSVFLVAPSSSDARLRRVTGIASGFVYAA
SLMGVTGVRESVGAAAEGLVNRVRGVTDLPVAVGLGVRDGAQAATVAGFADGVIVGTALV
GCLVDAERSGAGREAGIAAVRKLTADLAAGVRAGS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgggacagggcacaccggggcgggtcgcggatgttttcgcggcggcccgcaaggaaggc
cgcgcggtcctcgtcggctacctgccggcgggctacccgtcggtggacggcgcgatcgac
gcgttgcgcgcgatggtcgaggccggggtcgacatcgtcgagctcgggctgccgtactcg
gacccgacgatcgacgggccggtcatccaggaggccgtggacgcggcgctgcggggcggt
gtgaccaccgccgacgtgctgcgcaccgtcgaggccgtcgccgcgaccggcgcgccgacg
ctcgtgatgacctactggaacccgatcgagcggcacggtgtcgagcggttcgccgccgac
ctcgccgccgccgggggcgccggcacgatcacgccggacctgccgcccgaggaggccggc
ccgtggctggaggccgccggccggcacgggctcgactcggtgttcctggtcgcgcccagc
tcttcggacgcccggctgcgacgagtgaccggcatcgccagcggcttcgtctacgccgcg
tcgctgatgggcgtcaccggcgtccgggagtcggtcggcgccgcggccgagggcctggtc
aaccgggtgcgcggcgtcaccgacctgccggtggcggtcggtctgggggtccgggacggg
gcccaggcggcgaccgtggcgggcttcgccgacggagtgatcgtcggcaccgcgctggtc
ggctgcctggtcgacgcggaacgctccggcgccggccgcgaggctggcatcgccgcggtc
cgcaagctcaccgccgacctcgcggccggcgtccgcgccggttcctga

DBGET integrated database retrieval system