KEGG   Frankia sp. EuI1c: FraEuI1c_4970Help
Entry
FraEuI1c_4970     CDS       T01354                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FraEuI1c_4970
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FraEuI1c_4970
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FraEuI1c_4970
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FraEuI1c_4970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6120495..6121322)
Genome map
AA seq 275 aa AA seqDB search
MGQGTPGRVADVFAAARKEGRAVLVGYLPAGYPSVDGAIDALRAMVEAGVDIVELGLPYS
DPTIDGPVIQEAVDAALRGGVTTADVLRTVEAVAATGAPTLVMTYWNPIERHGVERFAAD
LAAAGGAGTITPDLPPEEAGPWLEAAGRHGLDSVFLVAPSSSDARLRRVTGIASGFVYAA
SLMGVTGVRESVGAAAEGLVNRVRGVTDLPVAVGLGVRDGAQAATVAGFADGVIVGTALV
GCLVDAERSGAGREAGIAAVRKLTADLAAGVRAGS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgggacagggcacaccggggcgggtcgcggatgttttcgcggcggcccgcaaggaaggc
cgcgcggtcctcgtcggctacctgccggcgggctacccgtcggtggacggcgcgatcgac
gcgttgcgcgcgatggtcgaggccggggtcgacatcgtcgagctcgggctgccgtactcg
gacccgacgatcgacgggccggtcatccaggaggccgtggacgcggcgctgcggggcggt
gtgaccaccgccgacgtgctgcgcaccgtcgaggccgtcgccgcgaccggcgcgccgacg
ctcgtgatgacctactggaacccgatcgagcggcacggtgtcgagcggttcgccgccgac
ctcgccgccgccgggggcgccggcacgatcacgccggacctgccgcccgaggaggccggc
ccgtggctggaggccgccggccggcacgggctcgactcggtgttcctggtcgcgcccagc
tcttcggacgcccggctgcgacgagtgaccggcatcgccagcggcttcgtctacgccgcg
tcgctgatgggcgtcaccggcgtccgggagtcggtcggcgccgcggccgagggcctggtc
aaccgggtgcgcggcgtcaccgacctgccggtggcggtcggtctgggggtccgggacggg
gcccaggcggcgaccgtggcgggcttcgccgacggagtgatcgtcggcaccgcgctggtc
ggctgcctggtcgacgcggaacgctccggcgccggccgcgaggctggcatcgccgcggtc
cgcaagctcaccgccgacctcgcggccggcgtccgcgccggttcctga

DBGET integrated database retrieval system