KEGG   Frankia sp. EuI1c: FraEuI1c_4971Help
Entry
FraEuI1c_4971     CDS       T01354                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fri  Frankia sp. EuI1c
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FraEuI1c_4971
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FraEuI1c_4971
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FraEuI1c_4971
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FraEuI1c_4971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6121418..6122710)
Genome map
AA seq 430 aa AA seqDB search
MSASSAGSTGLAASPAAADLGAGEWASVPDGLGHFGPFGGRFVPEALMAALDELTAAYDE
ARQDPAFVAELDGLLASYAGRPTPVTVAQRLTERIGGARLLLKREDLAHTGSHKINNVLG
QCLLTKRMGKTRVIAETGAGQHGVATATACALLGLECVVYMGEEDTQRQALNVARMRLLG
ATVVPVTSGSRTLKDAINEALRDWVATVEHTHYCIGSVMGPHPFPMLVRDFQRIIGVEAR
EQVLEITGRLPDAVVACVGGGSNAMGIFHRFIPDTSVALIGCEAGGDGLATGRHAAAIAG
GGSGVLHGMRSYFLQDEDGQTQVSHSISAGLDYPGIGPEHAWLHDTGRASYRVVDDTAAM
DALGLVAKTEGILVAIESAHAFAGAFDVARELGPDATVLVSCSGRGDKDVDTAARWFDLL
DGADGPATNG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcttccagtgccgggtcgaccggtcttgccgcttcgcctgccgccgctgacctg
ggcgcgggggagtgggccagcgtcccggacgggctgggccacttcgggccgttcggtggg
cggttcgtgccggaggcgctcatggcggcgctcgacgagctgaccgcggcctacgacgag
gcccgccaggacccggcgttcgtcgccgagctggacggcctgctggccagctacgccggc
cggccgacccccgtcaccgtggcccagcggctcaccgagcggatcggcggcgcccggctg
ctgctcaagcgcgaggacctcgcgcacaccggctctcacaagatcaacaacgtcctcggt
cagtgcctgctgaccaagcggatgggcaagacccgggtgatcgccgagaccggcgcgggc
cagcacggcgtcgccaccgcgaccgcctgcgccctgctcggcctcgagtgcgtcgtctac
atgggcgaggaggacacccagcgccaggcgctgaacgtcgcccggatgcggctgctcggc
gccaccgtcgtccccgtcacctccggcagccgcaccctcaaggacgccatcaacgaggcg
ctgcgggactgggtcgccaccgtcgagcacacccactactgcatcggctcggtgatgggc
ccccacccgttcccgatgctcgtccgcgacttccagcggatcatcggcgtcgaggcgcgc
gagcaggtgctcgagatcaccggacggctgccggacgcggtcgtcgcctgcgtcggcggc
ggctcgaacgcgatggggatcttccaccggttcatcccggacacctcggtcgcgctgatc
ggctgcgaggcgggcggcgacggcctggcgaccggccggcacgccgcagcgatcgccggt
ggcgggtccggcgtcctgcacgggatgcgctcgtacttcctgcaggacgaggacggccag
acccaggtctcgcactcgatctccgccggcctggactatcccggcatcgggcccgagcac
gcctggctgcacgacaccggccgggcctcctaccgggtcgtcgacgacaccgccgcgatg
gacgctctaggcctggtcgcgaagaccgagggcatcctggtcgcgatcgagagcgcgcac
gcgttcgccggggccttcgacgtcgcccgtgagctgggcccggacgcgaccgtcctcgtg
agctgctcaggccggggcgacaaggacgtcgacaccgccgcccgctggttcgacctgctc
gacggcgccgacggcccggccaccaacggctga

DBGET integrated database retrieval system