KEGG   Frankia sp. EuI1c: FraEuI1c_5131Help
Entry
FraEuI1c_5131     CDS       T01354                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fri  Frankia sp. EuI1c
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fri00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6313917..6316292)
Genome map
AA seq 791 aa AA seqDB search
MVTSDDPARATTRRDPAATQAGAPRSQPAAVAPDPSGPLGDVEPALARLAAMYGVAAGYL
DARDQPVAVAADAVRRVLELMGVDTADPAAALAAAQAAPWRRLGPPSVVVKASAPTAVTL
RLPAGLAPEAVRCELVLADGAVLPVTAGPAGERREVDGAQLVARPAPLPAGLPLGDHVLR
VRAGELESTTQVVAVPDRVPEPTWPAASPGQAAGAGSPAEAEPSSRPGGDGGPGARMWGW
MVQLYALRSAGSWGMGDYADLATLATWSGSAAGGRADVLLVNPLHAAAPTLPVQSSPYYP
ASRRFLSPLYLRPEDTPEYAAADAATRAAVDGHAAAAREAHLAADGFGELIDRDTVWKSK
RAALELLFAGSPGAGAAGAGAEVAEFALWCALAERHGADWRVWPAPLRDREPAALAAARS
ELADRVAFHHWLQARAEQQVAAAQAAAEAAGMRVGIVHDLAVGVDPAGADTWADRDAYAV
GVSIGAPPDTFNQQGQDWGLPPWRPDRLAATGYAPLRRMIAAVLGRGGGLRVDHILGLFR
LWWIPAGAGAGNGTYVRYDAEAMLGVLALEAAKAGALVVGEDLGTVEPTVATTLADFGVL
GSSVLWFENDADGVPLPPAEWRARTMASVTTHDLPTAAGFLLGEHIRARAERGLLARPVA
AETAEWRASRDALLAHLRAHGLLAPASEPETGDELAPEVVQEAAVGMHRLLVATPARIIL
AAPGDAVGDRHQPNLPSTVDSYPNWRLPVRDSDGRQVTLEELMADERVARLVAVLAEAAR
QPASESGAPHG
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacctccgacgatcccgcgcgcgccacgacccgacgcgacccggctgccacccag
gcgggcgctccccgttcccaaccggcggcagtcgcgccggacccgtccgggccgctcggc
gacgtcgaaccggccctggcccggctcgccgcgatgtacggcgtcgcggcgggctacctc
gacgccagggaccagccggtcgccgtcgcggcggacgccgtacgccgggtgctggagctg
atgggcgtcgacacggccgatccggccgccgcgctggcggccgcgcaggcggcaccgtgg
cggcggctgggcccgccgagcgtcgtcgtgaaggcctccgcgccgaccgccgtcacgctg
cggctgccggccgggcttgcccccgaggccgtccgctgcgagctggtgctggccgacgga
gcggtcctcccggtcacggccggaccggctggtgagcgacgcgaggtcgacggggcccag
ctggtcgcccggcccgcaccgctgcccgccgggctgccactcggcgaccacgtcctgcgc
gtgcgcgccggggagctggagtcgacgacacaggtcgtcgccgttcccgaccgggtgccg
gagccgacctggcccgccgcgagcccgggccaggcggccggtgccggttcgcccgccgag
gcggagccttcctcgcggcccggcggggacggcggtcccggcgcccggatgtggggctgg
atggtccagctgtacgcgctgcgctcggccggctcctgggggatgggcgactacgccgac
ctcgcgacgctcgcgacctggtccggttcggccgccggaggccgcgcggacgtgctgctg
gtcaacccgctgcacgcggccgcgccgacgctgccggtccagtcgtcgccctactacccg
gcgagccggcggttcctctcgcccctctacctgcgccccgaggacacgcccgagtacgcc
gccgccgacgcggcgacccgtgccgccgtggacggtcatgccgccgccgcgcgcgaggcc
cacctcgccgccgacgggttcggtgagctgatcgaccgggacacggtctggaagtccaag
cgcgcggccctcgagctgctgttcgccgggtcgcccggtgccggcgcggccggggccggg
gccgaggtggccgagttcgccctctggtgcgcgctcgccgagcggcacggcgccgactgg
cgggtctggccggcgccgctgcgggaccgggagccggccgccctggccgccgcgcggagc
gagctcgccgaccgggtcgcgttccaccactggctgcaggcgcgggccgagcagcaggtc
gccgcggcccaggcggccgccgaggccgccgggatgcgggtcggcatcgttcacgacctg
gccgtcggtgtcgacccggccggcgcggacacctgggccgaccgggacgcgtacgccgtc
ggggtgagcatcggcgccccgccggacacgttcaaccagcagggccaggactgggggctg
ccgccgtggcggcccgaccggctcgccgcgacgggctacgcgccgctgcgccggatgatc
gccgcggtgctggggcgcggcggcgggctgcgggtggaccacatcctcggcctgttccgg
ctgtggtggatcccggccggcgccggggccgggaacggcacgtatgtccgttacgacgcc
gaggcgatgctgggcgtgctcgcgctggaggcggcgaaggccggggccctggtcgtcggc
gaggacctcggcacggtggagccgacggtcgccacgacgctggccgacttcggcgtcctc
ggctcctccgtgctgtggttcgagaacgacgccgacggagtcccactgccgccggccgag
tggcgggcccggacgatggccagcgtcaccacccacgacctgccgaccgcggctggcttc
ctgctgggcgagcacatccgcgcccgcgcggagcgtggcctgctggcccggccggtcgcc
gcggagacggcggagtggcgcgccagccgggatgccctcctggcacacctgcgggcccac
ggcctgctcgcgccggcctcggagccggagaccggggacgagctggcgcctgaggtggtc
caggaggccgccgtcgggatgcaccggctactggtcgccaccccggcccggatcatcctc
gccgcgccgggcgacgccgtcggcgaccgtcaccagccgaatctgccgagcacggtggac
agctacccgaactggcgtcttccggtccgggactccgacggccgccaggtgacgctggag
gagctgatggccgacgagcgggtcgcccgcctcgtcgccgtcctcgccgaggccgcccgc
cagccagccagcgagtccggtgcaccacatgggtaa

DBGET integrated database retrieval system