KEGG   Frankia sp. EuI1c: FraEuI1c_5209Help
Entry
FraEuI1c_5209     CDS       T01354                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fri  Frankia sp. EuI1c
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FraEuI1c_5209
Enzymes [BR:fri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FraEuI1c_5209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6406412..6407323
Genome map
AA seq 303 aa AA seqDB search
MVVIGSINMDVVVTVERMPLPGETVAGGSVHQIPGGKGANQAVAARRLGAPTALVGAVGA
DGFGAVLAGFLGAERIDTSLVRMEHGPSGTALITVANGGENTVIVVAGANGSVSPARVAE
ATIRAGDVLLLQDEIPGETNEAAARAARAVGARTVLNLAPFRAPSPGLLAATDVLIVNET
EFAELVEAPRADAAAIAERLRAELTACNGQPVGDVVVTLGAQGALARIGGEVLALPGRRG
PVVDTTGAGDCFCGAFGASLAAGLPATAALERANAAAGLAVGRFGAGPAMPTATEVDAAL
SGV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtcatcggttcgatcaacatggacgtcgtcgtcacggtggagcggatgccgctg
cccggcgagacggtcgccggcggctcggtgcaccagattcccggcggcaagggcgcgaac
caggcggtcgccgcccgccggctcggcgccccgacggcgttggtcggcgcggtgggggcc
gacgggttcggcgcggtgctcgccggcttcctgggagcggagcggatcgacacctcgctg
gtccgcatggagcacgggccgtcgggcacggccctgatcacggtcgccaacggcggcgag
aacacggtgatcgtggtggccggggcgaacggctccgtcagcccggcccgggtggccgag
gcgacgatccgggccggcgacgtgctgctgctccaggacgagatccccggtgagacgaac
gaggccgccgcccgcgcggccagggccgtcggggcgaggacggtcctcaacctcgcgccg
ttccgggcgccgagccccggcctgttggccgcgaccgacgtcctgatcgtcaacgagacc
gagttcgccgagctggtcgaggccccgcgtgccgacgccgcggcgatcgccgaacgcctg
cgcgccgagttgaccgcctgcaacggccagccggtcggcgacgtcgtggtgaccctcggc
gcgcagggcgcgctggcccggatcggcggcgaggtgctggccctgcccggccggcgcggc
ccggtggtcgacacgaccggcgccggggactgcttctgcggcgccttcggcgcctcgctc
gccgccgggctgccggccaccgccgccctggaacgggccaacgccgccgcgggcctcgcg
gtcggccgcttcggcgccggcccggccatgccaaccgcgaccgaggtcgacgccgccctc
agcggcgtctag

DBGET integrated database retrieval system