KEGG   Frankia sp. EuI1c: FraEuI1c_5282Help
Entry
FraEuI1c_5282     CDS       T01354                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00790  Folate biosynthesis
fri01100  Metabolic pathways
fri02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FraEuI1c_5282
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FraEuI1c_5282
Enzymes [BR:fri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FraEuI1c_5282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: ADP83270
UniProt: E3J877
Position
6489572..6491305
Genome map
AA seq 577 aa AA seqDB search
MTSDGAGAPAGQNHPTTDRGAVSDTSRKTGPHRRSLLLGGLGLGATALAVAACGGSDSAT
PPAAPQLRAATPVPGVAEGVFGLGVASGDPLPDGVILWTRLAPKPTAGGGMPARDIPVDW
QVATDAGFRSVVRAGTATAQPAFAHSVHVDVRGLQPGRDYYYRFRAGTVLSPVGRTRTAA
APGAGPEAAGGSLAFALVSCQDFQNGYWPAFDAIAADRPDLVVHVGDYIYEYDPDSKFPD
RRHTTPQTPGLDQLQTLADYRNRYGQYKADPALQAAHRAAPWVVTWDDHEVENNYANLVD
EPGDTGAKHQDPATFARQRAAAYQAYYEHMPIRATLHPGSPDLQIYRRLTFGSLATLNVM
DTRQYRTPAPGNFASAIGPAALGADDTTGTMAGAAQEKWLQDGLAGSRTRWNLIAQQTMM
AQLDGQLPPGSGQMLTNLDQNDGYRPYRARVLAGVRDSKALNPIVLSGDLHCAWVNDLRV
DFDRPDTPVVATEFVCTSISSAFFLVSDEFVRDNNTRLNPHVRYFRGDRRGYTRFQVTPT
ECHADLRIVADISQRHSPVSTDTSWVIEDGHPGARPA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtgacggcgctggggcgccagcaggccagaaccacccgacgaccgaccgcggt
gcggtctcggataccagccggaagaccggcccgcatcggcgctcgctcctgttgggtggg
ctggggctgggtgccacggcgctggccgtggccgcgtgcggcggctccgacagcgccacc
ccgccggcggcgccacagctgcgcgcggcgacgcccgttccgggcgtggctgaaggagtc
ttcggcctcggcgtggcgagcggtgatccgctgcccgacggggtgatcctctggacccgc
ctcgcgcctaagccgaccgccggcggcgggatgccggctcgggacatcccggtcgactgg
caggtcgccaccgacgctggcttccgctcggtggtgcgcgccggcacggcgacggcgcag
ccggcgttcgcgcattcggtccacgtcgacgtccgcggcctgcagccggggcgcgactac
tactaccggttccgggccggcacggtgctcagcccggtcggccgcacccggaccgcggcg
gcgccgggagccggcccggaggcggccggtgggtcgctggcgttcgcgctcgtgtcctgc
caggacttccagaacggctactggcccgcgttcgacgcgatcgccgcggaccggccggac
ctcgtcgtgcacgtgggcgactacatctacgagtacgacccggacagcaagttcccggac
cgccggcacaccaccccgcagacgccaggtctcgaccagctccagaccctggccgactac
cggaaccgctacggccagtacaaggccgacccggcgctgcaggccgcccaccgggccgcg
ccctgggtcgtcacctgggacgaccacgaggttgagaacaactacgcgaacctcgtcgac
gagcccggcgacaccggggccaagcaccaggaccccgcgacgttcgcccgccagcgcgcg
gccgcctaccaggcctactacgagcacatgccgatccgcgcgacgctgcacccgggctcc
cccgacctgcagatctaccgccgcctgacctttggaagcctggcgacgctgaacgtcatg
gacacccggcagtaccgcacgccagcgcccggcaacttcgcctccgcgatcggaccggcg
gccctcggcgccgacgacaccaccggcacgatggcgggcgccgcgcaggagaagtggcta
caggacggactggccggctcccgcacccgctggaacctcatcgcgcagcagacgatgatg
gcccagctcgacggccaactgccgccaggaagcggccagatgctgacgaacctcgaccag
aacgacggctaccgcccctaccgcgcccgggtcctggccggcgtgcgcgacagcaaggcg
ctcaacccgatcgtcctgtccggggacctgcactgcgcctgggtgaacgacctgcgggtc
gacttcgaccggcccgacacgccggtcgtcgcgaccgagttcgtctgcacgtcgatcagc
tcggcgttcttcctggtcagcgacgagttcgtccgcgacaacaacacccggctgaacccg
cacgtccgctacttccgcggtgaccggcgcggctacacccgcttccaggtgacgccgacg
gagtgccacgccgacctgcggatcgtcgccgacatctcgcaacgccactcccccgtcagc
accgacacctcctgggtcatcgaggacggccaccccggcgccagacccgcctga

DBGET integrated database retrieval system