KEGG   Frankia sp. EuI1c: FraEuI1c_5590Help
Entry
FraEuI1c_5590     CDS       T01354                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
fri  Frankia sp. EuI1c
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FraEuI1c_5590
  Lipid metabolism
   00561 Glycerolipid metabolism
    FraEuI1c_5590
   00600 Sphingolipid metabolism
    FraEuI1c_5590
Enzymes [BR:fri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     FraEuI1c_5590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6853073..6854434
Genome map
AA seq 453 aa AA seqDB search
MTTVCFVGAGSAEFTRQLLRDLLTYDDLGPLTLVLHDVDPRRLELAEGLARVAVERHGRP
ATIRATQDRAAAVSGADFVINAVNIGGHAATLTDFEVPARFGLRQTIADTLGAGGIFRGL
RTFGFLDELATDMLAEAPDAWLLNYTNPMAMNIQFAATRHPELKVLGLCHSVYWTVHDLC
ELIDVPFDDVSFHSAGVNHQAWVLRWERDGVDLYPELDRRIATDPELARRVRVDMYRRLG
FYPTETSEHSAEYVPWYLHEPAEIERLRIPIDDYVGISARNLEDVEALMPAVAAGQYVEP
EEEAAEYAPQVIHSMVTGTARTIQATVRNEAPGNAGDPVLPGPAGLLIDNLPRGAAVEVP
CRIDAAGAVPVPVGDLPAQCAALNRTFLSVVDLTVRAAMLGRPDHIRHALMADPNTAATL
TVAEIWRLADEMVAAHGDRLPAPLRERLGNPSS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgtctgcttcgtcggcgccggatcggccgagttcacccggcagctgctgcgc
gacctgttgacctacgacgatctcgggccgctgacgctcgtcctgcacgacgtcgacccg
cgccggctggaactcgcggagggcctggcgcgcgtcgcggtcgagcggcacgggcgccca
gccacgatccgggctacccaggaccgcgcggcggcggtgagcggcgccgacttcgtcatc
aacgcggtcaacatcggcggccacgcggcgaccctgaccgacttcgaggtcccggcccgg
ttcgggctgcgccagacgatcgccgacacgctgggggccggcgggatcttccgcgggctg
cggaccttcggattcctcgacgagctggcgacggacatgctggccgaggccccggacgcc
tggctgctgaactacaccaacccgatggcgatgaacatccagttcgccgcgacccgccac
ccggagctgaaggtcctcgggctgtgccactccgtctactggacggtgcacgacctctgc
gagctgatcgacgtgccgttcgacgacgtgtcgttccacagcgccggggtcaaccaccag
gcctgggtgctgcgctgggagcgggacggggtggacctctacccggagctcgaccgccgc
atcgccacggaccccgaactggcccgccgggtccgggtcgacatgtaccgccggctgggc
ttctacccgaccgagaccagcgagcactcggccgagtacgtcccctggtatctgcacgag
ccggccgagatcgagcggctgcgcatcccgatcgacgactacgtcgggatcagcgcccgc
aacctggaggacgtcgaggcgctgatgcccgcggtggccgccggccagtacgtcgagccg
gaggaggaggccgccgagtatgccccgcaggtgatccacagcatggtcaccgggaccgcc
cgcacgatccaggcgacggtccgcaacgaggctcctgggaacgccggggatccggtactc
ccggggccggcagggctgctcatcgacaacctgccgcgcggggcggcggtcgaggttccc
tgccgcatcgacgcggccggcgcggttccggtcccggtcggggacctgcccgcgcagtgc
gccgcgctcaaccggacgtttctgtctgtggtcgacctgaccgtgcgggccgcgatgctc
ggccggcccgaccacatccgccacgcgctgatggccgaccccaacaccgcggcgaccctg
accgtcgccgagatctggcgcctggccgacgagatggtcgccgcgcacggcgaccgcctg
ccagcccccctccgcgaacgcctcggcaacccgtcctcctga

DBGET integrated database retrieval system