KEGG   Frankia sp. EuI1c: FraEuI1c_5590Help
Entry
FraEuI1c_5590     CDS       T01354                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
fri  Frankia sp. EuI1c
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fri00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fri00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fri00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6853073..6854434
Genome map
AA seq 453 aa AA seqDB search
MTTVCFVGAGSAEFTRQLLRDLLTYDDLGPLTLVLHDVDPRRLELAEGLARVAVERHGRP
ATIRATQDRAAAVSGADFVINAVNIGGHAATLTDFEVPARFGLRQTIADTLGAGGIFRGL
RTFGFLDELATDMLAEAPDAWLLNYTNPMAMNIQFAATRHPELKVLGLCHSVYWTVHDLC
ELIDVPFDDVSFHSAGVNHQAWVLRWERDGVDLYPELDRRIATDPELARRVRVDMYRRLG
FYPTETSEHSAEYVPWYLHEPAEIERLRIPIDDYVGISARNLEDVEALMPAVAAGQYVEP
EEEAAEYAPQVIHSMVTGTARTIQATVRNEAPGNAGDPVLPGPAGLLIDNLPRGAAVEVP
CRIDAAGAVPVPVGDLPAQCAALNRTFLSVVDLTVRAAMLGRPDHIRHALMADPNTAATL
TVAEIWRLADEMVAAHGDRLPAPLRERLGNPSS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgtctgcttcgtcggcgccggatcggccgagttcacccggcagctgctgcgc
gacctgttgacctacgacgatctcgggccgctgacgctcgtcctgcacgacgtcgacccg
cgccggctggaactcgcggagggcctggcgcgcgtcgcggtcgagcggcacgggcgccca
gccacgatccgggctacccaggaccgcgcggcggcggtgagcggcgccgacttcgtcatc
aacgcggtcaacatcggcggccacgcggcgaccctgaccgacttcgaggtcccggcccgg
ttcgggctgcgccagacgatcgccgacacgctgggggccggcgggatcttccgcgggctg
cggaccttcggattcctcgacgagctggcgacggacatgctggccgaggccccggacgcc
tggctgctgaactacaccaacccgatggcgatgaacatccagttcgccgcgacccgccac
ccggagctgaaggtcctcgggctgtgccactccgtctactggacggtgcacgacctctgc
gagctgatcgacgtgccgttcgacgacgtgtcgttccacagcgccggggtcaaccaccag
gcctgggtgctgcgctgggagcgggacggggtggacctctacccggagctcgaccgccgc
atcgccacggaccccgaactggcccgccgggtccgggtcgacatgtaccgccggctgggc
ttctacccgaccgagaccagcgagcactcggccgagtacgtcccctggtatctgcacgag
ccggccgagatcgagcggctgcgcatcccgatcgacgactacgtcgggatcagcgcccgc
aacctggaggacgtcgaggcgctgatgcccgcggtggccgccggccagtacgtcgagccg
gaggaggaggccgccgagtatgccccgcaggtgatccacagcatggtcaccgggaccgcc
cgcacgatccaggcgacggtccgcaacgaggctcctgggaacgccggggatccggtactc
ccggggccggcagggctgctcatcgacaacctgccgcgcggggcggcggtcgaggttccc
tgccgcatcgacgcggccggcgcggttccggtcccggtcggggacctgcccgcgcagtgc
gccgcgctcaaccggacgtttctgtctgtggtcgacctgaccgtgcgggccgcgatgctc
ggccggcccgaccacatccgccacgcgctgatggccgaccccaacaccgcggcgaccctg
accgtcgccgagatctggcgcctggccgacgagatggtcgccgcgcacggcgaccgcctg
ccagcccccctccgcgaacgcctcggcaacccgtcctcctga

DBGET integrated database retrieval system