KEGG   Frankia sp. EuI1c: FraEuI1c_5656Help
Entry
FraEuI1c_5656     CDS       T01354                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
fri  Frankia sp. EuI1c
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fri00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fri00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:fri00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6937288..6940347)
Genome map
AA seq 1019 aa AA seqDB search
MTATSFTAMPWDGSGFHAVRRLPMHGLRRPADVELDGAWEFQLLPSPTAPVGDVWKTVDV
PGLWTMSETDDRPHYTNVAMPFDEVPPQIPARNPTGVYRRSFALRPDPGRQVILRIGAAE
GLLRAFVNGHAVGISTDSHLAAEFDITDACVAGPDGEHTVELVVSKWSSVSYLEDQDQWW
HAGLSRSVSVHTVPRTRLADLKVHADYDPAAQRGGLRLRVSTAGLDGLRDEGWTVEVEAL
GERSTAPVAPLRDAPRLPALTGDRSVRPPRLIPPDLMDLPSLLAADAPIPADWAPAAAMM
GPSLRPLPVAGTAVLDRADLDVRPWSAESPHLYDVIVRLADPDGRIVDETTTRVGFRRVT
IEGRDLLVNGRRVLVQGVDRHDVDPATGRVMRPERLLAELSLLKRFNVNAIRTSHYPNDP
LFLDLCDEIGFYVVDEADIEAHAFSSALCDDPRYLPAFLDRVSRMVLRDRNHPCVIIWSL
GNETGYGANHDAAAAWVRRFDPTRPVQYEGAIASDWHGGHPSTDLVCPMYPSFESLAAYS
ADPRADRPLILCEYAYSQGNSNGGLAEYWAMFETLPGLQGGFIWEFTDHALDPDGDGRYR
YGGDFGDVPNDGIALLNGIAFPDLTPKPALYEARGLFSPVRIVSDAAAALAGTISVRNRQ
VFNDLGAFTFELQVEDGGESGPVTVDMPDVPAGTTGTLRIPEVVRARLEASSPLAVTLTV
RTRADTRWAPAATVIAAHQVVFERPAEPVAAPVPARLPVGEDGELAHPLLRTGPRLCLWR
ALTDNDRSFALDQRFVRSGFFQLTPRQVEIRPDGEGAAVTTRYATAFDTEVVHHRTIAAL
TPPDHPYTEYLLRERVVLPDDTEDALRVGVVFELCDGFDEARWVGLGPWENYPDRRSSAL
LGAWHSRIDDLAVPYLFPQENGGRGQTTELRLTGPAGTVSTFHQSPLHMTVRRHRVEELE
AASHWWELPPSAATVVHLDVAHRGLGTAVLGPDTRPRFRLPDREYAWTWRLRLDERPPR
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaccagcttcaccgccatgccgtgggacggctccgggttccacgccgtaaga
cggctgccgatgcacgggttgcggcggccggctgacgtcgagctcgacggggcgtgggag
ttccagctgctgcctagcccgacggcaccggtcggtgacgtctggaagacggtggacgtc
cccgggctctggacgatgtccgagaccgacgaccggccgcactacacgaacgtcgcgatg
ccgttcgacgaggtgccgccccagattccagcgcgcaatccgaccggggtctaccggcgc
tccttcgcgctgcggcccgaccccggacggcaggtgatcctgcggatcggggccgccgag
ggcctgctgcgggcgttcgtgaacgggcacgcggtcgggatcagcacggactcgcacctc
gccgcggagttcgacataaccgacgcctgcgtcgcgggcccggatggcgagcacaccgtt
gagctggtcgtctccaagtggtcatcggtctcctaccttgaggaccaggaccagtggtgg
cacgcgggcctcagccgctcggtgtccgtccacacggtgccacggacccggctggcggac
ctgaaggttcacgccgactacgacccggccgcccagcgcggcgggctgcgcctcagggtg
tccaccgcgggcctggacggcctgcgcgacgaaggatggacagtcgaggtcgaggcgctg
ggggaacgctcgacggcgcccgtggcgccgctgcgcgacgcgccgcggctgccagcgctc
acgggcgaccggtcggtccggccgcccaggctgatcccgcccgacctcatggacctgccc
tcgctgctggcggcggacgcccccatcccggcggactgggcgcccgcggccgccatgatg
ggtccatccctgcggccgttacccgtggccgggaccgccgtcctcgaccgcgccgacctc
gacgttcggccctggtcagcggagagcccgcacctgtacgacgtcatcgtccggctggcc
gacccggacgggcggatcgtcgacgagaccaccaccagggtcggattccgccgggtgacg
atcgagggccgcgacctgctggtcaacggccggcgcgtcctggtccagggggtcgaccgc
cacgacgtcgacccggcgaccggacgggtcatgcggccggagcggctgctggcggagctt
tcgctgctcaagcggttcaacgtcaacgccatccgcacgtcgcactacccgaacgacccg
ctgttcctcgatctttgcgacgagatcggcttctacgtcgtggacgaggcggacatcgag
gcgcatgccttctcgtcggcgctctgcgacgacccgcgctatctgcccgccttcctggac
cgggtgtcgcggatggtgctgcgcgaccgcaaccacccgtgcgtgatcatctggtcgctc
ggcaacgagaccggctacggcgccaaccacgacgccgcggcggcctgggtccgccgcttc
gaccccaccaggcccgtgcagtacgagggcgcgatcgcgtcggactggcatggcgggcac
ccgtcgaccgacctcgtgtgcccgatgtacccgtcgttcgagagcctcgccgcgtacagc
gccgacccgcgcgccgaccggccgctgatcctctgcgagtacgcgtactcccagggcaac
tcgaacggcgggctcgccgagtactgggcgatgttcgagacgcttcccgggctgcagggc
ggcttcatctgggagttcaccgaccacgccctggaccctgatggcgacggccgttaccgc
tacggcggggacttcggtgacgtccccaacgacgggatcgcgctgctcaacggcatcgcc
ttccccgacctcacgcccaagcccgcgctgtacgaggcgcgcgggctgttcagcccggtg
cggatcgtctccgacgccgccgccgcgctggccgggaccatcagcgtccgcaaccggcag
gtcttcaacgacctgggcgccttcacgttcgagctgcaggtggaggacgggggcgagagc
ggcccggtgaccgtcgacatgccggacgtccccgccgggacgaccgggacgctgcgcatc
cccgaggtggtgcgggcgcggctcgaagcgtcctcgccgctcgcggtcacgctgaccgtg
cggacgcgtgccgacacgcggtgggcgccggccgcgacggtgatcgccgcccaccaggtc
gtgttcgagcgccccgccgagcccgtcgcggcgcccgtacccgcgcggctccccgtcggc
gaggacggcgagctggcgcacccgctgctgcggaccggcccgcggctgtgcctgtggcga
gcactcaccgacaacgaccgctccttcgcgctcgaccagcgcttcgtgcgttccggtttc
ttccagctcacgccgcggcaggtcgagatccgcccggatggggagggcgccgcggtcacc
acgcgctacgccaccgcgttcgacacagaggtggtgcatcaccggaccatcgcggctctc
acgccacccgaccatccgtacaccgagtacctgctgcgcgagcgggtcgtcctcccggac
gacaccgaggacgcgttgcgggtcggggtggtgttcgagctgtgtgacggcttcgacgag
gcccgctgggtcggcctcggcccgtgggagaactaccccgaccgacgctcgtccgcgctt
ctcggcgcctggcacagccgtatcgacgacctcgccgtgccctacctgttcccgcaggag
aacggcgggcgtggtcagaccaccgaactgcgcctcaccggcccggctggcaccgtcagc
acctttcaccagtcaccgctgcacatgaccgtgcgccgccaccgcgtcgaggagctcgaa
gcggccagccactggtgggagctgccgccgagcgccgccacggtggtgcacctcgacgtg
gcgcaccgcggcctggggaccgcggtgctgggccccgacacccgcccgagattccggctc
cccgaccgtgagtacgcctggacgtggcgactgcgtctcgacgaacggccgccgcgctga

DBGET integrated database retrieval system