KEGG   Frankia sp. EuI1c: FraEuI1c_5724Help
Entry
FraEuI1c_5724     CDS       T01354                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
fri  Frankia sp. EuI1c
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FraEuI1c_5724
   01212 Fatty acid metabolism
    FraEuI1c_5724
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FraEuI1c_5724
   00650 Butanoate metabolism
    FraEuI1c_5724
  Lipid metabolism
   00071 Fatty acid degradation
    FraEuI1c_5724
   01040 Biosynthesis of unsaturated fatty acids
    FraEuI1c_5724
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_5724
   00310 Lysine degradation
    FraEuI1c_5724
   00380 Tryptophan metabolism
    FraEuI1c_5724
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FraEuI1c_5724
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FraEuI1c_5724
   00281 Geraniol degradation
    FraEuI1c_5724
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    FraEuI1c_5724
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     FraEuI1c_5724
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FraEuI1c_5724
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     FraEuI1c_5724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7036278..7038524)
Genome map
AA seq 748 aa AA seqDB search
MPEPTSAPVRPTVLPPMEGSEAAGSTPDSDRIGVIGWERDADGIVVLTVDDPDHAANTTN
AAFRASMGAVVDRLERARDTITGVVVTSAKKTFVTGADLRELVSLGPADRLAAFETAAAV
KDQLRRLETLGRPVVAAVGGAALGGGLEIALACHHRIAADVPGSQLGLPEVTLGLAPSGG
GIVRTVRLLGVRSALVNVLLAGQRYSPAQARALGLVDELVGSVAELLPAARAWIQANPDA
TARWDAPGYQIPGGGPALAAALPALPAGLRRQAAAEGAPAGPAILAAAVEGAQVDLATAS
VIESRYYAELVTGSVAKNMIQAFYFDLGRIGTAVRPAGQAPVAVTRAAVLGAGPTGASLA
YALAKAGVDVVLAGPSAEAAGLAKGYAERLVADAVRRGSTRPPAGEALLARITPTADQAA
LAGADVVIEATDPAAPAGTVELAAARDAVPEALLCVASAAPLAHQPPVVATSEPGDLVDV
VGLRLAGPADRTSLVEIVVGAGTADAALARAIDLVTQLRKTPIVVHEAAPGATAGAGVGG
GSFVGRLLGAFVAEGAAMVGAGVPAASVEQAGTQAGFPSSPLRLLDELTGPAVRGALGDD
ASAAAAVLDQMIELGRSGRAGGAGFYDYADGRPTGLWPGLRDRFGGTLDPAELAFEELVE
RLLVAVALAGVRALADGTVRTVAEVNIGSLTGAGFPAWTGGVLGYVNGFAGGPAGFVARA
HDLVARHGDRFAPPRSLVDRAARGELYD
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccgacgtcagcccccgtgcggccgacggtcctgccgccgatggaagggtcc
gaggcggccgggtccacgcccgacagcgaccggatcggtgtgatcggctgggagcgggac
gccgacgggatcgtcgtgctcaccgtcgacgacccggaccacgcggcgaacaccacgaac
gcggcgttccgcgcgtcgatgggcgccgtcgtcgaccgcctggaacgggcccgggacacg
atcaccggggttgtcgtcacgtcggcgaagaagacgttcgtcacgggggccgacctgcgg
gagctggtcagtctcggcccggcggaccggctcgcggcgttcgagacggccgcggccgtg
aaggaccagctgcgccggctggagacgctcggccgcccggtcgtcgcggcggtcggtggt
gccgcgctcggcggcggcctggagatcgcgctcgcctgccaccaccggatcgcggcggac
gtgcccggctcccagctcggcctgcccgaggtcacgctcgggctcgcgccgtcgggcggc
gggatcgtccggacggtgcggctgctcggggtgcgcagcgcgctggtcaacgtgcttttg
gcgggccagcggtacagcccggcgcaggcccgcgccctcgggctggtcgacgagctggtc
ggctccgtggctgagctgctgcccgcggcgcgggcgtggatccaggccaacccggacgcg
accgcccgctgggacgccccgggctaccagattcccggtggcgggccggcgctggccgcc
gcgctgccggcgctgcccgccgggctgcgccgccaggccgcggccgagggcgcgccggcg
ggaccggcgatcctggcggccgccgtcgagggcgcccaggtcgacctcgcgacggcgtcg
gtcatcgagtcgcggtactacgccgagctggtcaccggctcggtggcgaagaacatgatc
caggccttctacttcgacctcgggcggatcgggacggccgtgcgcccggcggggcaggca
ccggtcgccgtgacgagggccgcggtcctcggcgccgggccgaccggggcctcgctcgcg
tacgcgctcgccaaggcgggggtggacgtcgtcctcgccggcccgtcggccgaggccgcc
gggctggccaaggggtacgccgagcggctcgtcgccgacgcggtgcgccggggcagcacc
cggcccccggcaggggaggcgctgctcgcccggatcacaccgaccgcggaccaggcggcg
ctggccggcgcggacgtcgtcatcgaggcgaccgacccggccgcgcccgccggaaccgtc
gagctggccgcggcccgtgacgccgtaccggaggcgctgctgtgcgtggcctcggccgcg
ccactggcgcaccagccgccggtcgtcgcgacgtcggagcccggcgacctggtcgacgtc
gtgggcctgcggctggccggcccggcggaccggacctcgctcgtcgagatcgtcgtcggc
gcggggaccgcggacgccgcgctggcccgggcgatcgacctggtcacccagctgcgcaag
accccgatcgtcgtccacgaggccgcccccggcgccacggccggggcgggcgtcggcggt
gggtcgttcgtcggccggctgctcggggcgttcgtcgccgagggggccgcgatggtcggc
gccggggtgcccgccgcgtcggtcgagcaggccggcacgcaggccggcttcccgtcctcg
ccgctgcgtctgctcgacgagctgaccgggcccgccgtgcggggcgcgctcggcgacgac
gcgtccgccgccgcggcggtgctcgaccagatgatcgagctcggccggtcggggcgggct
ggcggcgccggtttctacgactacgccgacggtcgcccgaccggcctgtggccgggcctg
cgtgaccggttcggcggcacgctcgacccggctgagctggcgttcgaggagctggtcgag
cggctgctggtcgcggtggcgctggccggcgtccgcgcgctggcggacggcacggtgcgc
acggtggcggaggtcaacatcggttcgctcaccggcgccgggttcccagcctggaccggt
ggcgtgctcgggtacgtcaacggcttcgccggcgggccggccggcttcgtcgcccgggcg
catgacctcgtggcccggcacggcgaccgcttcgcgccgccgcggtctctggtcgaccgc
gccgcccgcggcgagctgtacgactga

DBGET integrated database retrieval system