KEGG   Frankia sp. EuI1c: FraEuI1c_5779Help
Entry
FraEuI1c_5779     CDS       T01354                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
fri  Frankia sp. EuI1c
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FraEuI1c_5779
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     FraEuI1c_5779
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     FraEuI1c_5779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7118142..7118753)
Genome map
AA seq 203 aa AA seqDB search
MTALTTWSASDPTTTTGSTVDRPEIESVLRALGFRLERWPLAPGLAPDAPAEDVLAAYRD
LIEGLVSAEGFVEVDVAALHPTGQPAFAATAAAARAKFLAEHTHADDEVRFFAAGRGVFY
LHTRDEARGEEVHAVLCEAGDLLFVPAGTTHWFDMGTEPSFTAVRFFRDPEGWVGDFTGS
DLATQFPDFDALAAQADAVTAGA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctgacgacctggtcggcgagcgacccgacgacgaccacgggctcgaccgtc
gaccggcccgagatcgagtcggtgctgcgcgcgctcggctttcggctggagcgctggccg
ctggcgcccgggctcgcgcccgacgcgccggccgaggacgtgctggccgcgtaccgcgac
ctgatcgagggactggtgtccgcggagggcttcgtcgaggtcgacgtcgccgcgctgcac
ccgaccgggcagccggccttcgcggcgacggcggcggccgcccgggcgaagttcctggcc
gagcacacccatgccgacgacgaggtccggttctttgccgccgggcggggcgtcttctac
ctgcacacccgggacgaggcccgcggcgaggaggtgcacgccgtgctgtgcgaggccggc
gacctgctcttcgtccccgccggcaccacccactggttcgacatgggcacggagccctcc
ttcaccgcggtccggttcttccgtgaccccgagggctgggtcggcgacttcaccggcagc
gacctcgccacccaattccccgacttcgacgcgctcgcggcccaggcggacgcggtcacg
gcgggggcgtga

DBGET integrated database retrieval system