KEGG   Frankia sp. EuI1c: FraEuI1c_5871Help
Entry
FraEuI1c_5871     CDS       T01354                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fri  Frankia sp. EuI1c
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fri00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7223404..7224504
Genome map
AA seq 366 aa AA seqDB search
MTGSHDGPGAGADPVPQTGAPTGAPVPPYAAREAAAELPDGPGYAGLATFCGRPWLETEA
ELLARRPDVAVVGAPFDIATTHRPGARFGPRALRALAYDPGTYHLDLGIEIFEWLDVVDA
GDAHCPHGLTEASHANIRAKVNQVARNGIFPLIVGGDHSITWPAATAVAEAVGWGELGLL
HFDAHADTADIIDGNLASHGTPMRRLIESGAVRGRNFVQVGLRGYWPPPDVFAWMRENGL
RWHLMHEVWERGSRAVIADAIAEAVDGCKALYLSVDIDVLDPGFAPGTGTPEPGGMNPAD
LLRAVRQIALDTPLVAADIVEVSPPFDHADTTVNSAHRVAMEVFAALAHRRRTAAGGVPD
LPGTAP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacgggatcgcacgacgggccgggcgcgggcgcagacccggtgccgcagacaggtgcg
ccgaccggcgcgccggtgccgccgtatgccgcgcgggaggccgcggccgagctgccggac
ggccccggctacgcgggcctcgcgacgttctgcggccggccgtggctggagaccgaggcc
gagctgctggcccggcgcccggacgtggccgtcgtcggcgccccgttcgacatcgccacc
acgcaccggcccggcgcccggttcggcccgcgggcgctgcgtgccctggcctacgacccg
ggtacctaccacctcgacctcggcatcgagatcttcgagtggctggacgtcgtcgacgcc
ggcgacgcgcactgcccacacgggctgaccgaggcgtctcacgccaacatccgtgccaag
gtcaaccaggtggcgagaaacgggatcttcccgctcatcgtcggcggcgaccactcgatc
acctggccggcggcgacggccgtggccgaggcggtcggctggggcgagctcggcctgctg
cacttcgacgcccacgccgacaccgccgacatcatcgacggcaacctggcctcgcacggc
accccgatgcgccggctgatcgagtccggcgcggtccggggacgcaacttcgtccaggtg
ggcctgcgcggctactggccgccgccggacgtcttcgcctggatgcgcgagaacgggctg
cgttggcacctgatgcacgaggtctgggaacggggctcgcgcgccgtcatcgccgacgcc
atcgccgaggcggtcgacggctgcaaggcgctgtacctctccgtcgacatcgacgtgctg
gaccccgggttcgcgcccggcaccggcacgcccgaaccgggcgggatgaacccggccgac
ctgctgcgcgccgtccgccagatcgcgctggacaccccgctggtcgccgccgacatcgtc
gaggtctcgccgcccttcgaccacgccgacacgacggtcaacagcgcccaccgggtggcg
atggaggttttcgccgcgctggcccaccgccgccgcaccgccgccggcggcgtccccgac
ctcccgggcacagcgccttag

DBGET integrated database retrieval system