KEGG   Frankia sp. EuI1c: FraEuI1c_5982Help
Entry
FraEuI1c_5982     CDS       T01354                                 

Definition
(GenBank) putative cytochrome c oxidase, subunit III
  KO
K02164  
nitric oxide reductase NorE protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7363294..7363884
Genome map
AA seq 196 aa AA seqDB search
MTTAQPTAPTAQKAPKRVPGEAGMWFFVLFETLIFTSYFGVYLYYRAQHEAAYLQAQSHL
DLWLGVLGTIALLTSSWSVARCVQTARAGRYQTALRDAALTAGFGVVFLGLKIAEWARQI
HAGNTFTSNDFFQYYFFLTAIHCIHLLIGFVVLGVLVHQLSSPRRRSQEVIETCATYWHT
VDFLWVLIFALLYVVR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccgcgcagccgacggccccgacggcgcagaaggccccgaagcgggtgcccggc
gaggcgggcatgtggttcttcgtcctcttcgagaccctgatcttcacctcgtacttcggc
gtctacctctactaccgcgcccagcacgaggccgcgtacctccaggcccagtcgcatctc
gacctctggctcggagtgctcggcacgatcgccctgctgaccagctcgtggtcggtggcc
cggtgcgtccagacggcgcgcgccggccgctaccagaccgccctgcgggacgcggccctg
accgctggcttcggcgtcgtcttcctcgggctcaagatcgccgagtgggcccggcagatc
cacgcgggcaacacgttcaccagcaacgacttcttccagtactacttcttcctcaccgcg
atccactgcattcatctgctgatcggcttcgtcgtcctcggcgtcctcgtccatcagctc
tcgagcccgaggcgacgctcgcaggaggtcatcgagacctgcgccacctactggcacacc
gtcgacttcctctgggtgctgatcttcgctctgctctacgtcgtgaggtga

DBGET integrated database retrieval system