KEGG   Frankia sp. EuI1c: FraEuI1c_5986Help
Entry
FraEuI1c_5986     CDS       T01354                                 

Definition
(GenBank) integral membrane protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7367867..7368277
Genome map
AA seq 136 aa AA seqDB search
MVATQDLAYDYPVLGAFWTMLWIFLWAIWLVLVIRVVVDIFRDRESSGWAKAGWLAFVLI
LPFFGILAYVIVKGQAMADRDSRRVEDQRSTLNAYIRDVAGGSNKDVDDLTRLSRLRASG
DITDAEFQRAKEKILH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggtggctacccaggaccttgcttatgactatccggtgctaggcgccttctggacgatg
ctctggatctttctctgggcgatctggctggtcctcgtcattcgagtggttgtcgacatc
ttccgagacagggaatcgagcggatgggcgaaggccggctggctggcgttcgtcctgatc
ctgcccttcttcgggatcctcgcctatgtcatcgttaaggggcaggccatggccgaccgg
gactcgcgccgggtcgaggaccagcgcagcacgctcaacgcctacatccgcgacgtggcc
ggcgggagcaacaaggacgtcgacgacctgaccaggctttcccggctgcgggccagcggt
gacatcaccgacgccgagttccagcgcgccaaggaaaagattctgcattga

DBGET integrated database retrieval system