KEGG   Frankia sp. EuI1c: FraEuI1c_5987Help
Entry
FraEuI1c_5987     CDS       T01354                                 

Definition
(GenBank) Protein of unknown function DUF2252
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7368464..7369951
Genome map
AA seq 495 aa AA seqDB search
MTILATAPPAHRPPRRPAEGEPNGSRQHGSRQHGAGPDAARRADQGRAARASAPRRAHAE
YVSAPDRADPIDLIDRQSRSRVPELVPLRYQRMTESPFRFYRGAAAIMASDLAATPTSGL
TVQLCGDAHLLNFRLLASPERRLVFDINDFDETLPGPWEWDVKRFATSLVIAARANGFGS
AERRGIVTTAVGAYRGWMHRFATMTNLDVWYAHIDVDELAPRLTDALGKQASKRVSRATS
RARSRDRLRAFAKLTEVVDGERRFAADPPLLVPISELHTGRDRDLLMRWLSSIVEEYSAT
LSADRRSLLARYRLVDFARKVVGVGSVGTRCWVALLLGRDDGDPLLLQIKEAETSVLADH
LSGSAYGNQGERVVAGQRLMQAASDIFLGWQRVDGLDGHKRDFYVRQLQDWKGIAEPERM
DPDGLALFGRLCAATLARAHARSGDSIAIAAYLGGGTTFDRAVGAFAEAYADQNEADHAA
LVEAVRSGRVSATAP
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttgccaccgctcccccggcgcatcgtccgccgcggcggcccgccgaagga
gagccgaacggcagcaggcagcacggctctcgccagcacggcgccgggccggacgcggcg
cggcgcgcggaccagggaagagccgcccgggcctcggccccgcgccgagcccacgccgag
tacgtctcggcgccggaccgggccgacccgatcgacctgatcgaccggcagtcacgcagc
cgagtgcccgaactggtccccctccgctaccagcggatgacggaatcgccgttcaggttc
taccggggcgccgcggcgatcatggcctcggatctcgcggccacgccgacctcgggcctc
accgtccagctctgcggagacgcgcacctgctgaacttccggctgctcgcctcgcccgag
cgacggctggtgttcgacatcaacgacttcgacgagacccttcccggcccgtgggagtgg
gacgtgaagcggttcgccaccagcctggtcatcgccgcgcgcgccaacggcttcggctcg
gccgaacgacgggggatcgtcacaacggcggtcggggcctaccgcggctggatgcaccgg
ttcgcgacgatgaccaacctcgacgtctggtacgcccacatcgacgtcgacgagctggcc
ccgcggctcacggacgcgctgggcaagcaggcctccaagcgtgtgtcgcgagcgacctcg
cgggcccggtcccgcgaccggctgcgggcgttcgccaagctcaccgaggttgtcgacggt
gaacgacgattcgccgccgatcctccgctgctcgtcccgatcagcgagctgcacaccggg
agggatcgggacctgctgatgcgatggctcagctcgatcgtcgaggagtactccgccacg
ctgtcggccgaccggcgctccctgctcgcccggtaccgcctcgtcgacttcgcccgcaag
gtcgtcggcgtcggcagcgtgggcactcgctgctgggtcgcgctgctgctcggccgcgac
gacggcgacccgctcctgctgcagatcaaggaggccgagacgtcggtcctggccgatcac
ctgtccgggagcgcgtacggcaaccagggggaacgggtggtcgccgggcaacgcctcatg
caggccgccagcgacatcttcctcggctggcagcgggtggacggccttgacgggcacaag
cgcgacttctacgtgcggcagttgcaggactggaagggcatcgcggagccggagcgcatg
gaccccgacggcctggcgctgttcgggcgcctgtgcgcggccaccctcgcgcgggcgcac
gcgcggtcgggcgacagcatcgcgatcgcggcctacctgggcggtgggacgacgttcgac
cgggcggtcggcgccttcgcggaggcgtacgcggaccagaacgaggccgaccacgccgca
ctggtcgaagcggtccgcagcggccgggtcagcgccaccgcgccctga

DBGET integrated database retrieval system